Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 531131..531767 | Replicon | chromosome |
| Accession | NZ_CP126081 | ||
| Organism | Bacillus pumilus strain B2_10 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K2MHT4 |
| Locus tag | QNH35_RS02560 | Protein ID | WP_003214169.1 |
| Coordinates | 531417..531767 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | QNH35_RS02555 | Protein ID | WP_003214273.1 |
| Coordinates | 531131..531412 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH35_RS02535 (QNH35_02535) | 527277..527882 | - | 606 | WP_126741642.1 | rhomboid family intramembrane serine protease | - |
| QNH35_RS02540 (QNH35_02540) | 527977..528342 | + | 366 | WP_217013202.1 | holo-ACP synthase | - |
| QNH35_RS02545 (QNH35_02545) | 528503..529519 | + | 1017 | WP_113754968.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH35_RS02550 (QNH35_02550) | 529655..530836 | + | 1182 | WP_217013203.1 | alanine racemase | - |
| QNH35_RS02555 (QNH35_02555) | 531131..531412 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| QNH35_RS02560 (QNH35_02560) | 531417..531767 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QNH35_RS02565 (QNH35_02565) | 531881..532711 | + | 831 | WP_044140569.1 | RsbT co-antagonist protein RsbRA | - |
| QNH35_RS02570 (QNH35_02570) | 532716..533084 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| QNH35_RS02575 (QNH35_02575) | 533087..533488 | + | 402 | WP_283924168.1 | anti-sigma regulatory factor | - |
| QNH35_RS02580 (QNH35_02580) | 533499..534506 | + | 1008 | WP_065097543.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH35_RS02585 (QNH35_02585) | 534566..534895 | + | 330 | WP_044140572.1 | anti-sigma factor antagonist | - |
| QNH35_RS02590 (QNH35_02590) | 534892..535380 | + | 489 | WP_044140573.1 | anti-sigma B factor RsbW | - |
| QNH35_RS02595 (QNH35_02595) | 535346..536134 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
| QNH35_RS02600 (QNH35_02600) | 536134..536733 | + | 600 | WP_044140574.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T282587 WP_003214169.1 NZ_CP126081:531417-531767 [Bacillus pumilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K2MHT4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |