Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 236532..237168 | Replicon | chromosome |
Accession | NZ_CP126080 | ||
Organism | Mesobacillus sp. AQ2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A3Q9QS43 |
Locus tag | QNH36_RS01280 | Protein ID | WP_041967053.1 |
Coordinates | 236818..237168 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | W4RP20 |
Locus tag | QNH36_RS01275 | Protein ID | WP_031308192.1 |
Coordinates | 236532..236813 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH36_RS01255 (QNH36_01255) | 232583..233167 | - | 585 | WP_144481172.1 | rhomboid family intramembrane serine protease | - |
QNH36_RS01260 (QNH36_01260) | 233315..233668 | + | 354 | WP_251544793.1 | holo-ACP synthase | - |
QNH36_RS01265 (QNH36_01265) | 233860..234873 | + | 1014 | WP_283904492.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH36_RS01270 (QNH36_01270) | 235181..236338 | + | 1158 | WP_251544792.1 | alanine racemase | - |
QNH36_RS01275 (QNH36_01275) | 236532..236813 | + | 282 | WP_031308192.1 | hypothetical protein | Antitoxin |
QNH36_RS01280 (QNH36_01280) | 236818..237168 | + | 351 | WP_041967053.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH36_RS01285 (QNH36_01285) | 237803..238636 | + | 834 | WP_144481164.1 | RsbT co-antagonist protein RsbRA | - |
QNH36_RS01290 (QNH36_01290) | 238633..238989 | + | 357 | WP_041967776.1 | STAS domain-containing protein | - |
QNH36_RS01295 (QNH36_01295) | 238994..239395 | + | 402 | WP_144481162.1 | anti-sigma regulatory factor | - |
QNH36_RS01300 (QNH36_01300) | 239407..240417 | + | 1011 | WP_144481160.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH36_RS01305 (QNH36_01305) | 240476..240808 | + | 333 | WP_144481158.1 | anti-sigma factor antagonist | - |
QNH36_RS01310 (QNH36_01310) | 240805..241278 | + | 474 | WP_283904493.1 | anti-sigma B factor RsbW | - |
QNH36_RS01315 (QNH36_01315) | 241256..242050 | + | 795 | WP_144481156.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13020.06 Da Isoelectric Point: 4.8998
>T282586 WP_041967053.1 NZ_CP126080:236818-237168 [Mesobacillus sp. AQ2]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q9QS43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W4RP20 |