Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 541149..541802 | Replicon | chromosome |
| Accession | NZ_CP126078 | ||
| Organism | Brevibacillus agri strain ACCC03016 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | J2PLP3 |
| Locus tag | QNK09_RS02870 | Protein ID | WP_005830205.1 |
| Coordinates | 541452..541802 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A3M8AYL7 |
| Locus tag | QNK09_RS02865 | Protein ID | WP_025845698.1 |
| Coordinates | 541149..541448 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNK09_RS02845 (QNK09_02845) | 536627..537664 | + | 1038 | WP_005830195.1 | DUF4367 domain-containing protein | - |
| QNK09_RS02850 (QNK09_02850) | 537871..538992 | + | 1122 | WP_283858603.1 | hypothetical protein | - |
| QNK09_RS02855 (QNK09_02855) | 539325..539765 | + | 441 | WP_005830198.1 | hypothetical protein | - |
| QNK09_RS02860 (QNK09_02860) | 539768..540970 | + | 1203 | WP_007776941.1 | alanine racemase | - |
| QNK09_RS02865 (QNK09_02865) | 541149..541448 | + | 300 | WP_025845698.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QNK09_RS02870 (QNK09_02870) | 541452..541802 | + | 351 | WP_005830205.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNK09_RS02875 (QNK09_02875) | 542104..542460 | + | 357 | WP_007776946.1 | anti-sigma regulatory factor | - |
| QNK09_RS02880 (QNK09_02880) | 542454..543455 | + | 1002 | WP_007776949.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNK09_RS02885 (QNK09_02885) | 543481..543807 | + | 327 | WP_005830210.1 | anti-sigma factor antagonist | - |
| QNK09_RS02890 (QNK09_02890) | 543807..544301 | + | 495 | WP_005830211.1 | anti-sigma B factor RsbW | - |
| QNK09_RS02895 (QNK09_02895) | 544270..545067 | + | 798 | WP_005830213.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T282584 WP_005830205.1 NZ_CP126078:541452-541802 [Brevibacillus agri]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J2PLP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M8AYL7 |