Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 2729862..2730510 | Replicon | chromosome |
Accession | NZ_CP126077 | ||
Organism | Virgibacillus halodenitrificans strain ACCC02857 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A6L8JWB3 |
Locus tag | QNH47_RS13495 | Protein ID | WP_019379217.1 |
Coordinates | 2729862..2730221 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QNH47_RS13500 | Protein ID | WP_019379218.1 |
Coordinates | 2730226..2730510 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH47_RS13460 (QNH47_13460) | 2725078..2725869 | - | 792 | WP_060681900.1 | RNA polymerase sigma factor SigB | - |
QNH47_RS13465 (QNH47_13465) | 2725841..2726317 | - | 477 | WP_019379211.1 | anti-sigma B factor RsbW | - |
QNH47_RS13470 (QNH47_13470) | 2726317..2726649 | - | 333 | WP_019379212.1 | STAS domain-containing protein | - |
QNH47_RS13475 (QNH47_13475) | 2726755..2727768 | - | 1014 | WP_019379213.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH47_RS13480 (QNH47_13480) | 2727876..2728277 | - | 402 | WP_121615802.1 | anti-sigma regulatory factor | - |
QNH47_RS13485 (QNH47_13485) | 2728280..2728636 | - | 357 | WP_019379215.1 | STAS domain-containing protein | - |
QNH47_RS13490 (QNH47_13490) | 2728642..2729511 | - | 870 | WP_160804815.1 | RsbT co-antagonist protein RsbRA | - |
QNH47_RS13495 (QNH47_13495) | 2729862..2730221 | - | 360 | WP_019379217.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNH47_RS13500 (QNH47_13500) | 2730226..2730510 | - | 285 | WP_019379218.1 | hypothetical protein | Antitoxin |
QNH47_RS13505 (QNH47_13505) | 2730673..2731797 | - | 1125 | WP_283872873.1 | alanine racemase | - |
QNH47_RS13510 (QNH47_13510) | 2731988..2732998 | - | 1011 | WP_283872874.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH47_RS13515 (QNH47_13515) | 2733086..2734606 | - | 1521 | WP_283872876.1 | NAD(P)H-hydrate dehydratase | - |
QNH47_RS13520 (QNH47_13520) | 2734666..2735025 | - | 360 | WP_060681891.1 | holo-ACP synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13377.53 Da Isoelectric Point: 8.4940
>T282583 WP_019379217.1 NZ_CP126077:c2730221-2729862 [Virgibacillus halodenitrificans]
MIVQRGEVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDAEMMNKINQALEISLGLKDMYDH
MIVQRGEVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDAEMMNKINQALEISLGLKDMYDH
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|