Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 6817869..6818440 | Replicon | chromosome |
| Accession | NZ_CP126066 | ||
| Organism | Streptomyces sp. NA07423 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | QFW82_RS28190 | Protein ID | WP_079257839.1 |
| Coordinates | 6818066..6818440 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A1P8XVF0 |
| Locus tag | QFW82_RS28185 | Protein ID | WP_069863663.1 |
| Coordinates | 6817869..6818066 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW82_RS28165 (QFW82_28165) | 6813284..6814189 | + | 906 | WP_069863657.1 | LysR family transcriptional regulator | - |
| QFW82_RS28170 (QFW82_28170) | 6814363..6814932 | + | 570 | WP_079257842.1 | cysteine dioxygenase family protein | - |
| QFW82_RS28175 (QFW82_28175) | 6814929..6816035 | + | 1107 | WP_283886490.1 | putative sulfate exporter family transporter | - |
| QFW82_RS28180 (QFW82_28180) | 6816342..6817835 | + | 1494 | WP_283886491.1 | MFS transporter | - |
| QFW82_RS28185 (QFW82_28185) | 6817869..6818066 | + | 198 | WP_069863663.1 | Arc family DNA-binding protein | Antitoxin |
| QFW82_RS28190 (QFW82_28190) | 6818066..6818440 | + | 375 | WP_079257839.1 | Fic family protein | Toxin |
| QFW82_RS28195 (QFW82_28195) | 6818552..6820348 | + | 1797 | WP_283886492.1 | DEAD/DEAH box helicase | - |
| QFW82_RS28200 (QFW82_28200) | 6821113..6821754 | + | 642 | WP_069863676.1 | helix-turn-helix domain-containing protein | - |
| QFW82_RS28205 (QFW82_28205) | 6821897..6822682 | + | 786 | WP_283886493.1 | S16 family serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14001.81 Da Isoelectric Point: 4.7465
>T282542 WP_079257839.1 NZ_CP126066:6818066-6818440 [Streptomyces sp. NA07423]
MHYLTLPELLNLAERLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESSARNHALVDGNKRLSWYATWVFL
HINGHPLHADFDVDEAERFVLSVCQGELDVAKIAEGLTRFTERM
MHYLTLPELLNLAERLGESEVRDYGLLESALARPQASVFGQDAYPDVWQKAAALMESSARNHALVDGNKRLSWYATWVFL
HINGHPLHADFDVDEAERFVLSVCQGELDVAKIAEGLTRFTERM
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|