Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 72057..72700 Replicon plasmid p5_CS00491
Accession NZ_CP126063
Organism Klebsiella pneumoniae subsp. pneumoniae strain CS00491

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QM175_RS28070 Protein ID WP_283903546.1
Coordinates 72284..72700 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QM175_RS28065 Protein ID WP_001261282.1
Coordinates 72057..72287 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM175_RS28025 67255..67728 + 474 WP_004152341.1 YkgJ family cysteine cluster protein -
QM175_RS28030 67820..68050 + 231 WP_011977773.1 hypothetical protein -
QM175_RS28035 68942..69724 - 783 WP_004152340.1 site-specific integrase -
QM175_RS28040 69724..70056 - 333 WP_004152339.1 hypothetical protein -
QM175_RS28045 70063..70461 - 399 WP_004171440.1 hypothetical protein -
QM175_RS28050 70487..70816 - 330 WP_004152337.1 hypothetical protein -
QM175_RS28055 70844..71152 - 309 WP_004152336.1 hypothetical protein -
QM175_RS28060 71639..72100 - 462 WP_072093212.1 hypothetical protein -
QM175_RS28065 72057..72287 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QM175_RS28070 72284..72700 + 417 WP_283903546.1 type II toxin-antitoxin system VapC family toxin Toxin
QM175_RS28075 72774..73463 + 690 Protein_88 AAA family ATPase -
QM175_RS28080 73518..74215 + 698 WP_223174630.1 IS1 family transposase -
QM175_RS28085 74231..74341 + 111 Protein_90 mercuric transport protein periplasmic component -
QM175_RS28090 74377..74799 + 423 WP_001340589.1 organomercurial transporter MerC -
QM175_RS28095 74851..76545 + 1695 WP_000105636.1 mercury(II) reductase -
QM175_RS28100 76563..76925 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
QM175_RS28105 76922..77158 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1A / blaOXA-9 / blaKPC-3 - 1..114870 114870
- flank IS/Tn - - 65867..67135 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15122.56 Da        Isoelectric Point: 7.1084

>T282541 WP_283903546.1 NZ_CP126063:72284-72700 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGLNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT282541 WP_001261282.1 NZ_CP126063:72057-72287 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References