Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4553448..4554105 | Replicon | chromosome |
Accession | NZ_CP126058 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain CS00491 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QM175_RS21925 | Protein ID | WP_002916310.1 |
Coordinates | 4553448..4553858 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QM175_RS21930 | Protein ID | WP_002916312.1 |
Coordinates | 4553839..4554105 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM175_RS21905 (4549448) | 4549448..4551181 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QM175_RS21910 (4551187) | 4551187..4551900 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QM175_RS21915 (4551923) | 4551923..4552819 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QM175_RS21920 (4552920) | 4552920..4553441 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
QM175_RS21925 (4553448) | 4553448..4553858 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
QM175_RS21930 (4553839) | 4553839..4554105 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QM175_RS21935 (4554351) | 4554351..4555334 | + | 984 | WP_283903528.1 | tRNA-modifying protein YgfZ | - |
QM175_RS21940 (4555433) | 4555433..4556092 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
QM175_RS21945 (4556256) | 4556256..4556567 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
QM175_RS21950 (4556617) | 4556617..4557345 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QM175_RS21955 (4557464) | 4557464..4558897 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T282538 WP_002916310.1 NZ_CP126058:c4553858-4553448 [Klebsiella pneumoniae subsp. pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |