Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 621710..622413 | Replicon | chromosome |
Accession | NZ_CP126058 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain CS00491 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | QM175_RS02910 | Protein ID | WP_071994632.1 |
Coordinates | 622072..622413 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | QM175_RS02905 | Protein ID | WP_032434296.1 |
Coordinates | 621710..622051 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM175_RS02870 (616865) | 616865..617739 | + | 875 | Protein_540 | GTPase family protein | - |
QM175_RS02875 (617983) | 617983..618699 | + | 717 | WP_032434305.1 | WYL domain-containing protein | - |
QM175_RS02880 (618735) | 618735..619187 | + | 453 | WP_032410767.1 | hypothetical protein | - |
QM175_RS02885 (619259) | 619259..619732 | + | 474 | WP_032434303.1 | hypothetical protein | - |
QM175_RS02890 (619852) | 619852..620673 | + | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
QM175_RS02895 (620704) | 620704..621144 | + | 441 | WP_032434300.1 | antirestriction protein | - |
QM175_RS02900 (621157) | 621157..621699 | + | 543 | WP_032434298.1 | DNA repair protein RadC | - |
QM175_RS02905 (621710) | 621710..622051 | + | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QM175_RS02910 (622072) | 622072..622413 | + | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
QM175_RS02915 (622605) | 622605..624638 | - | 2034 | WP_050598589.1 | hypothetical protein | - |
QM175_RS02920 (625229) | 625229..626098 | - | 870 | WP_023317468.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 589118..634694 | 45576 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T282529 WP_071994632.1 NZ_CP126058:622072-622413 [Klebsiella pneumoniae subsp. pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12893.40 Da Isoelectric Point: 5.9612
>AT282529 WP_032434296.1 NZ_CP126058:621710-622051 [Klebsiella pneumoniae subsp. pneumoniae]
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGEFSNAESLKLDEVFPHFISQMESMLTTGEMNPRH
AHFFTLYHNGFTCEADTLGSYGYVYIAVYPTQR
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGEFSNAESLKLDEVFPHFISQMESMLTTGEMNPRH
AHFFTLYHNGFTCEADTLGSYGYVYIAVYPTQR
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|