Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 529172..529688 | Replicon | chromosome |
| Accession | NZ_CP126058 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain CS00491 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | QM175_RS02515 | Protein ID | WP_004178374.1 |
| Coordinates | 529404..529688 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | QM175_RS02510 | Protein ID | WP_032434351.1 |
| Coordinates | 529172..529414 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM175_RS02495 (525201) | 525201..525941 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| QM175_RS02500 (526007) | 526007..527161 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| QM175_RS02505 (527184) | 527184..529094 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| QM175_RS02510 (529172) | 529172..529414 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QM175_RS02515 (529404) | 529404..529688 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM175_RS02520 (529692) | 529692..530156 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QM175_RS02525 (530398) | 530398..532536 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QM175_RS02530 (532893) | 532893..533636 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QM175_RS02535 (533639) | 533639..533812 | - | 174 | WP_032414379.1 | hypothetical protein | - |
| QM175_RS02540 (533942) | 533942..534205 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T282528 WP_004178374.1 NZ_CP126058:529404-529688 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|