Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 44634..45259 | Replicon | chromosome |
| Accession | NZ_CP126058 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain CS00491 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | QM175_RS00205 | Protein ID | WP_002882817.1 |
| Coordinates | 44876..45259 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | QM175_RS00200 | Protein ID | WP_004150355.1 |
| Coordinates | 44634..44876 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM175_RS00175 (40625) | 40625..41224 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| QM175_RS00180 (41218) | 41218..42078 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| QM175_RS00185 (42075) | 42075..42512 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| QM175_RS00190 (42557) | 42557..43498 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| QM175_RS00195 (43512) | 43512..44429 | - | 918 | WP_009484979.1 | alpha/beta hydrolase | - |
| QM175_RS00200 (44634) | 44634..44876 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| QM175_RS00205 (44876) | 44876..45259 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QM175_RS00210 (45433) | 45433..46362 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| QM175_RS00215 (46359) | 46359..46994 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QM175_RS00220 (46991) | 46991..47893 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T282526 WP_002882817.1 NZ_CP126058:44876-45259 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |