Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 1570104..1570705 | Replicon | chromosome |
Accession | NZ_CP126055 | ||
Organism | Pasteurella multocida strain P030653/1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QNN13_RS07575 | Protein ID | WP_078819687.1 |
Coordinates | 1570104..1570418 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QNN13_RS07580 | Protein ID | WP_078819686.1 |
Coordinates | 1570415..1570705 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNN13_RS07535 (QNN13_07535) | 1565329..1565697 | - | 369 | Protein_1447 | Bro-N domain-containing protein | - |
QNN13_RS07540 (QNN13_07540) | 1566101..1566757 | - | 657 | WP_014390711.1 | Bro-N domain-containing protein | - |
QNN13_RS07545 (QNN13_07545) | 1567042..1567878 | - | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
QNN13_RS07550 (QNN13_07550) | 1567989..1568366 | - | 378 | WP_014390713.1 | hypothetical protein | - |
QNN13_RS07555 (QNN13_07555) | 1568341..1568532 | - | 192 | WP_014390714.1 | hypothetical protein | - |
QNN13_RS07570 (QNN13_07570) | 1569419..1569646 | - | 228 | WP_099821843.1 | hypothetical protein | - |
QNN13_RS07575 (QNN13_07575) | 1570104..1570418 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QNN13_RS07580 (QNN13_07580) | 1570415..1570705 | + | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
QNN13_RS07585 (QNN13_07585) | 1570731..1571135 | - | 405 | WP_146024473.1 | hypothetical protein | - |
QNN13_RS07590 (QNN13_07590) | 1571165..1573009 | - | 1845 | WP_265362803.1 | DEAD/DEAH box helicase family protein | - |
QNN13_RS07595 (QNN13_07595) | 1573220..1573897 | - | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
QNN13_RS07600 (QNN13_07600) | 1574021..1574218 | + | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
QNN13_RS07605 (QNN13_07605) | 1574268..1574720 | + | 453 | WP_014390720.1 | hypothetical protein | - |
QNN13_RS07610 (QNN13_07610) | 1574779..1575480 | + | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1546029..1599821 | 53792 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T282524 WP_078819687.1 NZ_CP126055:1570104-1570418 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|