Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 968007..968581 | Replicon | chromosome |
Accession | NZ_CP126055 | ||
Organism | Pasteurella multocida strain P030653/1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A849CFF7 |
Locus tag | QNN13_RS04760 | Protein ID | WP_014667974.1 |
Coordinates | 968297..968581 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A849CG04 |
Locus tag | QNN13_RS04755 | Protein ID | WP_014391174.1 |
Coordinates | 968007..968300 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNN13_RS04735 (QNN13_04735) | 963173..964264 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
QNN13_RS04740 (QNN13_04740) | 964613..966403 | + | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
QNN13_RS04745 (QNN13_04745) | 966448..966915 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
QNN13_RS04750 (QNN13_04750) | 966933..967610 | + | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
QNN13_RS04755 (QNN13_04755) | 968007..968300 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
QNN13_RS04760 (QNN13_04760) | 968297..968581 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
QNN13_RS04770 (QNN13_04770) | 969875..970136 | - | 262 | Protein_907 | hypothetical protein | - |
QNN13_RS04775 (QNN13_04775) | 970480..970632 | - | 153 | WP_014391177.1 | hypothetical protein | - |
QNN13_RS04780 (QNN13_04780) | 970932..973118 | - | 2187 | WP_014667973.1 | S8 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 969875..970036 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T282523 WP_014667974.1 NZ_CP126055:c968581-968297 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CFF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CG04 |