Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 5778765..5779381 | Replicon | chromosome |
Accession | NZ_CP125996 | ||
Organism | Gordonia sp. L191 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QNM97_RS26090 | Protein ID | WP_208793031.1 |
Coordinates | 5778765..5779172 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QNM97_RS26095 | Protein ID | WP_208793030.1 |
Coordinates | 5779169..5779381 (-) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM97_RS26070 (QNM97_26070) | 5774288..5774806 | + | 519 | WP_283823333.1 | phenolic acid decarboxylase | - |
QNM97_RS26075 (QNM97_26075) | 5774905..5775348 | + | 444 | WP_283820968.1 | DUF4186 domain-containing protein | - |
QNM97_RS26080 (QNM97_26080) | 5775454..5776125 | + | 672 | WP_283820969.1 | alpha/beta hydrolase-fold protein | - |
QNM97_RS26085 (QNM97_26085) | 5776343..5778682 | + | 2340 | WP_283820970.1 | endopeptidase La | - |
QNM97_RS26090 (QNM97_26090) | 5778765..5779172 | - | 408 | WP_208793031.1 | PIN domain-containing protein | Toxin |
QNM97_RS26095 (QNM97_26095) | 5779169..5779381 | - | 213 | WP_208793030.1 | CopG family transcriptional regulator | Antitoxin |
QNM97_RS26100 (QNM97_26100) | 5779465..5779917 | - | 453 | WP_283820971.1 | hypothetical protein | - |
QNM97_RS26105 (QNM97_26105) | 5779961..5781130 | - | 1170 | WP_283820972.1 | LLM class flavin-dependent oxidoreductase | - |
QNM97_RS26110 (QNM97_26110) | 5781269..5781628 | + | 360 | WP_208793027.1 | hypothetical protein | - |
QNM97_RS26115 (QNM97_26115) | 5781681..5782112 | + | 432 | WP_283820973.1 | hypothetical protein | - |
QNM97_RS26120 (QNM97_26120) | 5782115..5782420 | + | 306 | WP_283820974.1 | DUF6036 family nucleotidyltransferase | - |
QNM97_RS26125 (QNM97_26125) | 5782587..5783303 | - | 717 | WP_283820975.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14613.66 Da Isoelectric Point: 4.4922
>T282520 WP_208793031.1 NZ_CP125996:c5779172-5778765 [Gordonia sp. L191]
VILDTSALLAYFDSAEPQHSAVAEIIESHSGPLVISPFVIAELDYLLLTRHGTRAEQVVLSELTSGAWELASMTRSRIVT
ATAIVERYSDIPIGVTDASNIVLADAYQTSLIATLDHRHFSILRLMDGSPPTIVP
VILDTSALLAYFDSAEPQHSAVAEIIESHSGPLVISPFVIAELDYLLLTRHGTRAEQVVLSELTSGAWELASMTRSRIVT
ATAIVERYSDIPIGVTDASNIVLADAYQTSLIATLDHRHFSILRLMDGSPPTIVP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|