Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2412081..2413056 | Replicon | chromosome |
Accession | NZ_CP125992 | ||
Organism | Bacillus cereus strain FFI_gr_36 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | C3GJ28 |
Locus tag | QM226_RS12380 | Protein ID | WP_003297560.1 |
Coordinates | 2412081..2412818 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QM226_RS12385 | Protein ID | WP_061686604.1 |
Coordinates | 2412931..2413056 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM226_RS12360 (QM226_002479) | 2407809..2408591 | + | 783 | WP_000381787.1 | class I SAM-dependent methyltransferase | - |
QM226_RS12365 (QM226_002480) | 2408713..2410398 | - | 1686 | WP_283729851.1 | alpha-keto acid decarboxylase family protein | - |
QM226_RS12370 (QM226_002481) | 2410505..2410987 | + | 483 | WP_000191912.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QM226_RS12375 (QM226_002482) | 2411155..2411892 | + | 738 | WP_000594156.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QM226_RS12380 (QM226_002483) | 2412081..2412818 | + | 738 | WP_003297560.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QM226_RS12385 (QM226_002484) | 2412931..2413056 | + | 126 | WP_061686604.1 | hypothetical protein | Antitoxin |
QM226_RS12390 (QM226_002485) | 2413133..2413309 | + | 177 | WP_000808046.1 | stage II sporulation protein SB | - |
QM226_RS12395 (QM226_002486) | 2413453..2414922 | + | 1470 | WP_000287522.1 | beta-Ala-His dipeptidase | - |
QM226_RS12400 (QM226_002487) | 2415449..2415919 | - | 471 | WP_029438359.1 | DUF5065 family protein | - |
QM226_RS12405 (QM226_002488) | 2416375..2417031 | + | 657 | WP_075666799.1 | CatB-related O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28373.07 Da Isoelectric Point: 8.2672
>T282517 WP_003297560.1 NZ_CP125992:2412081-2412818 [Bacillus cereus]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|