Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2328670..2329645 | Replicon | chromosome |
Accession | NZ_CP125989 | ||
Organism | Bacillus cereus strain FFI_gr_46 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QM225_RS12070 | Protein ID | WP_283730748.1 |
Coordinates | 2328670..2329407 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | QM225_RS12075 | Protein ID | WP_000588712.1 |
Coordinates | 2329520..2329645 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM225_RS12040 (QM225_002414) | 2323745..2324455 | + | 711 | WP_283730671.1 | class I SAM-dependent methyltransferase | - |
QM225_RS12045 (QM225_002415) | 2324575..2324982 | + | 408 | WP_000072480.1 | VOC family protein | - |
QM225_RS12050 (QM225_002416) | 2325088..2325180 | + | 93 | Protein_2291 | methyltransferase | - |
QM225_RS12055 (QM225_002417) | 2325302..2326987 | - | 1686 | WP_283730672.1 | alpha-keto acid decarboxylase family protein | - |
QM225_RS12060 (QM225_002418) | 2327094..2327576 | + | 483 | WP_000191911.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QM225_RS12065 (QM225_002419) | 2327744..2328481 | + | 738 | WP_000594156.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QM225_RS12070 (QM225_002420) | 2328670..2329407 | + | 738 | WP_283730748.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QM225_RS12075 (QM225_002421) | 2329520..2329645 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
QM225_RS12080 (QM225_002422) | 2329722..2329898 | + | 177 | WP_000808045.1 | stage II sporulation protein SB | - |
QM225_RS12085 (QM225_002423) | 2330042..2331511 | + | 1470 | WP_283730673.1 | beta-Ala-His dipeptidase | - |
QM225_RS12090 (QM225_002424) | 2331746..2332216 | - | 471 | WP_000670597.1 | DUF5065 family protein | - |
QM225_RS12095 (QM225_002425) | 2332393..2333013 | + | 621 | WP_002036390.1 | SGNH/GDSL hydrolase family protein | - |
QM225_RS12100 (QM225_002426) | 2333236..2333769 | + | 534 | WP_000438322.1 | sigma-70 family RNA polymerase sigma factor | - |
QM225_RS12105 (QM225_002427) | 2333759..2334586 | + | 828 | WP_001060391.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28345.02 Da Isoelectric Point: 8.2672
>T282515 WP_283730748.1 NZ_CP125989:2328670-2329407 [Bacillus cereus]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAAFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAAFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|