Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 248486..249128 | Replicon | chromosome |
Accession | NZ_CP125989 | ||
Organism | Bacillus cereus strain FFI_gr_46 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | QM225_RS01405 | Protein ID | WP_000635963.1 |
Coordinates | 248778..249128 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QM225_RS01400 | Protein ID | WP_000004570.1 |
Coordinates | 248486..248773 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM225_RS01375 (QM225_000275) | 243802..244764 | + | 963 | WP_000961155.1 | UV DNA damage repair endonuclease UvsE | - |
QM225_RS01380 (QM225_000276) | 244757..245329 | - | 573 | WP_000906926.1 | rhomboid family intramembrane serine protease | - |
QM225_RS01385 (QM225_000277) | 245422..245781 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
QM225_RS01390 (QM225_000278) | 245938..246888 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
QM225_RS01395 (QM225_000279) | 247007..248176 | + | 1170 | WP_075396319.1 | alanine racemase | - |
QM225_RS01400 (QM225_000280) | 248486..248773 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QM225_RS01405 (QM225_000281) | 248778..249128 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QM225_RS01410 (QM225_000282) | 249196..251364 | + | 2169 | WP_000426225.1 | Tex family protein | - |
QM225_RS01415 (QM225_000283) | 251422..251538 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QM225_RS01420 (QM225_000284) | 251734..252192 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282514 WP_000635963.1 NZ_CP125989:248778-249128 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |