Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 5326767..5327366 | Replicon | chromosome |
Accession | NZ_CP125986 | ||
Organism | Pseudomonas rhodesiae strain 3.8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5C5P148 |
Locus tag | QMY54_RS27370 | Protein ID | WP_034095668.1 |
Coordinates | 5326767..5327072 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A8I1E6D6 |
Locus tag | QMY54_RS27375 | Protein ID | WP_034095667.1 |
Coordinates | 5327076..5327366 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY54_RS27350 (QMY54_05453) | 5322380..5323006 | - | 627 | WP_284184948.1 | precorrin-8X methylmutase | - |
QMY54_RS27355 (QMY54_05454) | 5322999..5324288 | - | 1290 | WP_284184949.1 | precorrin-3B synthase | - |
QMY54_RS27360 (QMY54_05455) | 5324384..5325589 | + | 1206 | WP_284184950.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
QMY54_RS27365 (QMY54_05456) | 5325586..5326320 | + | 735 | WP_220698556.1 | cobalt-precorrin-6A reductase | - |
QMY54_RS27370 (QMY54_05457) | 5326767..5327072 | + | 306 | WP_034095668.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMY54_RS27375 (QMY54_05458) | 5327076..5327366 | + | 291 | WP_034095667.1 | putative addiction module antidote protein | Antitoxin |
QMY54_RS27380 (QMY54_05459) | 5327464..5327886 | + | 423 | WP_284184951.1 | DUF2946 domain-containing protein | - |
QMY54_RS27385 (QMY54_05460) | 5327907..5328389 | + | 483 | WP_284184952.1 | copper chaperone PCu(A)C | - |
QMY54_RS27390 (QMY54_05461) | 5328401..5328802 | + | 402 | WP_034095664.1 | DUF2946 domain-containing protein | - |
QMY54_RS27395 (QMY54_05462) | 5328896..5330956 | + | 2061 | WP_284184953.1 | TonB-dependent copper receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11640.25 Da Isoelectric Point: 5.8918
>T282512 WP_034095668.1 NZ_CP125986:5326767-5327072 [Pseudomonas rhodesiae]
MTIEFNETIEFANWLEAVRDPFVKVRVVKRVRMAEAGNFGDCESVGDGVFEMRIHYGPGYRVYFTRRDEVVYLLLIGGDK
STQSRDIKRAKQIAINFGSEE
MTIEFNETIEFANWLEAVRDPFVKVRVVKRVRMAEAGNFGDCESVGDGVFEMRIHYGPGYRVYFTRRDEVVYLLLIGGDK
STQSRDIKRAKQIAINFGSEE
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|