Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 161781..162474 | Replicon | plasmid unnamed |
Accession | NZ_CP125985 | ||
Organism | Pseudomonas rhodesiae strain 3.8 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0D9A9G0 |
Locus tag | QMY54_RS00905 | Protein ID | WP_042933781.1 |
Coordinates | 161781..162158 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | QMY54_RS00910 | Protein ID | WP_001172026.1 |
Coordinates | 162139..162474 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY54_RS00890 (QMY54_00176) | 156892..157737 | - | 846 | WP_003464995.1 | AraC family transcriptional regulator | - |
QMY54_RS00895 (QMY54_00177) | 157974..161003 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
QMY54_RS00900 (QMY54_00178) | 160987..161589 | - | 603 | WP_010465829.1 | recombinase family protein | - |
QMY54_RS00905 (QMY54_00179) | 161781..162158 | + | 378 | WP_042933781.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMY54_RS00910 (QMY54_00180) | 162139..162474 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QMY54_RS00915 (QMY54_00181) | 162489..162824 | + | 336 | WP_000741275.1 | hypothetical protein | - |
QMY54_RS00920 (QMY54_00182) | 162848..163174 | + | 327 | WP_000091614.1 | hypothetical protein | - |
QMY54_RS00925 (QMY54_00183) | 163171..163551 | + | 381 | WP_001054412.1 | hypothetical protein | - |
QMY54_RS00930 (QMY54_00184) | 163708..164962 | + | 1255 | Protein_185 | HD-GYP domain-containing protein | - |
QMY54_RS00935 (QMY54_00186) | 165865..166101 | - | 237 | WP_078465740.1 | hypothetical protein | - |
QMY54_RS00940 (QMY54_00187) | 166186..166761 | - | 576 | WP_078465739.1 | hypothetical protein | - |
QMY54_RS00945 | 167043..167204 | + | 162 | WP_161952140.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..514920 | 514920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13735.81 Da Isoelectric Point: 9.4693
>T282508 WP_042933781.1 NZ_CP125985:161781-162158 [Pseudomonas rhodesiae]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGTGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGTGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D9A9G0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |