Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
Location | 582238..582862 | Replicon | chromosome |
Accession | NZ_CP125966 | ||
Organism | Helicobacter pylori strain H390r |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QM974_RS02810 | Protein ID | WP_271331027.1 |
Coordinates | 582596..582862 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QM974_RS02805 | Protein ID | WP_271331026.1 |
Coordinates | 582238..582615 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM974_RS02775 (QM974_02775) | 577382..578493 | + | 1112 | Protein_528 | hydrogenase formation protein HypD | - |
QM974_RS02780 (QM974_02780) | 578444..579070 | - | 627 | WP_271331024.1 | helicase DnaB modulator | - |
QM974_RS02795 (QM974_02795) | 579481..581706 | + | 2226 | WP_283722679.1 | Hop family adhesin BabA | - |
QM974_RS02800 (QM974_02800) | 581654..581959 | - | 306 | WP_283722680.1 | hypothetical protein | - |
QM974_RS02805 (QM974_02805) | 582238..582615 | + | 378 | WP_271331026.1 | hypothetical protein | Antitoxin |
QM974_RS02810 (QM974_02810) | 582596..582862 | + | 267 | WP_271331027.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QM974_RS02815 (QM974_02815) | 582941..583252 | + | 312 | WP_180669626.1 | type II toxin-antitoxin system antitoxin | - |
QM974_RS02820 (QM974_02820) | 583239..583511 | + | 273 | WP_271331028.1 | type II toxin-antitoxin system YafQ family toxin | - |
QM974_RS02825 (QM974_02825) | 583617..584141 | - | 525 | WP_001120212.1 | acyl-CoA thioesterase | - |
QM974_RS02830 (QM974_02830) | 584284..585126 | + | 843 | WP_271331029.1 | SDR family oxidoreductase | - |
QM974_RS02835 (QM974_02835) | 585119..586099 | + | 981 | WP_000921438.1 | iron ABC transporter permease | - |
QM974_RS02840 (QM974_02840) | 586099..586866 | + | 768 | WP_024422093.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10235.10 Da Isoelectric Point: 9.9517
>T282504 WP_271331027.1 NZ_CP125966:582596-582862 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLGSQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLGSQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14699.62 Da Isoelectric Point: 7.8469
>AT282504 WP_271331026.1 NZ_CP125966:582238-582615 [Helicobacter pylori]
MPNSPTKKDYTQYSEKQLFNLIHQLEQKIKRMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDNKRDCCL
GHKIPNIETQQAMRDALNKETDLIVDDFSSYSDERKKALGVETQS
MPNSPTKKDYTQYSEKQLFNLIHQLEQKIKRMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDNKRDCCL
GHKIPNIETQQAMRDALNKETDLIVDDFSSYSDERKKALGVETQS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|