Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 1576596..1577143 | Replicon | chromosome |
| Accession | NZ_CP125961 | ||
| Organism | Pseudomonas brassicacearum strain R401 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G8Q8L6 |
| Locus tag | QLH64_RS07010 | Protein ID | WP_014337667.1 |
| Coordinates | 1576596..1576871 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G8Q8L7 |
| Locus tag | QLH64_RS07015 | Protein ID | WP_014337668.1 |
| Coordinates | 1576871..1577143 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH64_RS06990 (QLH64_06990) | 1572943..1573572 | + | 630 | WP_014337664.1 | isochorismate family cysteine hydrolase YcaC | - |
| QLH64_RS06995 (QLH64_06995) | 1573813..1574691 | + | 879 | WP_057450026.1 | LysR family transcriptional regulator | - |
| QLH64_RS07000 (QLH64_07000) | 1574748..1575224 | - | 477 | WP_003203396.1 | hemerythrin domain-containing protein | - |
| QLH64_RS07005 (QLH64_07005) | 1575423..1576532 | - | 1110 | WP_057450024.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLH64_RS07010 (QLH64_07010) | 1576596..1576871 | - | 276 | WP_014337667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QLH64_RS07015 (QLH64_07015) | 1576871..1577143 | - | 273 | WP_014337668.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| QLH64_RS07020 (QLH64_07020) | 1577560..1578027 | + | 468 | WP_057450109.1 | GNAT family N-acetyltransferase | - |
| QLH64_RS07025 (QLH64_07025) | 1578056..1578592 | - | 537 | WP_057450023.1 | DUF2867 domain-containing protein | - |
| QLH64_RS07030 (QLH64_07030) | 1578616..1579260 | - | 645 | WP_057450107.1 | DJ-1/PfpI family protein | - |
| QLH64_RS07035 (QLH64_07035) | 1579387..1579941 | + | 555 | WP_003203390.1 | TetR/AcrR family transcriptional regulator | - |
| QLH64_RS07040 (QLH64_07040) | 1580064..1581527 | - | 1464 | WP_003203388.1 | NADH-quinone oxidoreductase subunit NuoN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10619.17 Da Isoelectric Point: 9.5555
>T282500 WP_014337667.1 NZ_CP125961:c1576871-1576596 [Pseudomonas brassicacearum]
MELKWTSKALSDIARLYEFLAAVNQPAAARTVQQLTAAPTSLLANPRIGERLEEFEPRDVRRIQVGRYEMRYEIAGSTLY
LLRLWHTREDR
MELKWTSKALSDIARLYEFLAAVNQPAAARTVQQLTAAPTSLLANPRIGERLEEFEPRDVRRIQVGRYEMRYEIAGSTLY
LLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|