Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 759794..760307 Replicon chromosome
Accession NZ_CP125961
Organism Pseudomonas brassicacearum strain R401

Toxin (Protein)


Gene name relE Uniprot ID A0A0Q7AG62
Locus tag QLH64_RS03385 Protein ID WP_057449709.1
Coordinates 759794..760078 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QLH64_RS03390 Protein ID WP_057449710.1
Coordinates 760068..760307 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLH64_RS03365 (QLH64_03365) 755535..756683 + 1149 WP_014336993.1 L-threonine dehydrogenase -
QLH64_RS03370 (QLH64_03370) 756680..757843 - 1164 WP_057449706.1 MFS transporter -
QLH64_RS03375 (QLH64_03375) 757857..759092 - 1236 WP_057449707.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
QLH64_RS03380 (QLH64_03380) 759350..759763 + 414 WP_057449708.1 fosfomycin resistance glutathione transferase -
QLH64_RS03385 (QLH64_03385) 759794..760078 - 285 WP_057449709.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QLH64_RS03390 (QLH64_03390) 760068..760307 - 240 WP_057449710.1 ribbon-helix-helix protein, CopG family Antitoxin
QLH64_RS03395 (QLH64_03395) 760558..761907 + 1350 WP_057449711.1 GGDEF domain-containing protein -
QLH64_RS03400 (QLH64_03400) 762233..762736 + 504 WP_057449712.1 DUF4142 domain-containing protein -
QLH64_RS03405 (QLH64_03405) 762826..763230 - 405 WP_057449713.1 low affinity iron permease family protein -
QLH64_RS03410 (QLH64_03410) 763406..763552 + 147 WP_164488482.1 hypothetical protein -
QLH64_RS03415 (QLH64_03415) 763673..764083 - 411 WP_018606974.1 type II toxin-antitoxin system HicB family antitoxin -
QLH64_RS03420 (QLH64_03420) 764124..764300 - 177 Protein_671 type II toxin-antitoxin system HicA family toxin -
QLH64_RS03425 (QLH64_03425) 764772..765131 - 360 WP_018606969.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 759350..765433 6083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-81)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-41)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10874.63 Da        Isoelectric Point: 10.7322

>T282499 WP_057449709.1 NZ_CP125961:c760078-759794 [Pseudomonas brassicacearum]
MQVEWLRTALKNLDDEAAYIALDNPKAAAHFVKAILMSVEQLAQFPASGREGRLAGTREWVVPDRPYLIPYRVRHGRVQI
LRLFHTRRLPPNAW

Download         Length: 285 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8675.81 Da        Isoelectric Point: 4.3085

>AT282499 WP_057449710.1 NZ_CP125961:c760307-760068 [Pseudomonas brassicacearum]
MSVMSLRLPDEVAETLAILAKATGRSKSFLAVDALREYLAREAWQIKEIQEALHEADAGDFASPEDVNAIAEKWMNNAG

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q7AG62

Antitoxin

Source ID Structure

References