Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3143556..3144174 | Replicon | chromosome |
| Accession | NZ_CP125947 | ||
| Organism | Comamonas sp. ZM22 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QMY55_RS14620 | Protein ID | WP_283484921.1 |
| Coordinates | 3143878..3144174 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QMY55_RS14615 | Protein ID | WP_283484920.1 |
| Coordinates | 3143556..3143873 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMY55_RS14585 (QMY55_14585) | 3138616..3139311 | + | 696 | WP_283484914.1 | hypothetical protein | - |
| QMY55_RS14590 (QMY55_14590) | 3139511..3139882 | + | 372 | WP_283484915.1 | type I restriction endonuclease subunit M | - |
| QMY55_RS14595 (QMY55_14595) | 3139882..3140613 | + | 732 | WP_283484916.1 | hypothetical protein | - |
| QMY55_RS14600 (QMY55_14600) | 3140619..3141014 | - | 396 | WP_283484917.1 | helix-turn-helix transcriptional regulator | - |
| QMY55_RS14605 (QMY55_14605) | 3141116..3142258 | + | 1143 | WP_283484918.1 | hypothetical protein | - |
| QMY55_RS14610 (QMY55_14610) | 3142439..3143488 | + | 1050 | WP_283484919.1 | dienelactone hydrolase family protein | - |
| QMY55_RS14615 (QMY55_14615) | 3143556..3143873 | - | 318 | WP_283484920.1 | putative addiction module antidote protein | Antitoxin |
| QMY55_RS14620 (QMY55_14620) | 3143878..3144174 | - | 297 | WP_283484921.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMY55_RS14625 (QMY55_14625) | 3144358..3145506 | - | 1149 | WP_283484922.1 | phage/plasmid replication protein | - |
| QMY55_RS14630 (QMY55_14630) | 3145674..3146615 | - | 942 | WP_283484923.1 | AAA family ATPase | - |
| QMY55_RS14635 (QMY55_14635) | 3146720..3147007 | - | 288 | WP_283484924.1 | hypothetical protein | - |
| QMY55_RS14640 (QMY55_14640) | 3147528..3148055 | + | 528 | Protein_2847 | DUF45 domain-containing protein | - |
| QMY55_RS14645 (QMY55_14645) | 3148393..3149103 | - | 711 | WP_283484925.1 | DUF6499 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3137278..3159766 | 22488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10730.39 Da Isoelectric Point: 9.7118
>T282490 WP_283484921.1 NZ_CP125947:c3144174-3143878 [Comamonas sp. ZM22]
MIQVLRTAAFDDWLQALRDKVGQRQVLARLTRLSLGNWGDCKPVGGEVTELRIDSGPGYRVYCWRAGDVVVVALGGGDKS
TQQKDIAKAQAMVKELKG
MIQVLRTAAFDDWLQALRDKVGQRQVLARLTRLSLGNWGDCKPVGGEVTELRIDSGPGYRVYCWRAGDVVVVALGGGDKS
TQQKDIAKAQAMVKELKG
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|