Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1068849..1069417 | Replicon | chromosome |
Accession | NZ_CP125946 | ||
Organism | Rothia sp. SD9660Na |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QM007_RS05160 | Protein ID | WP_185174621.1 |
Coordinates | 1069070..1069417 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QM007_RS05155 | Protein ID | WP_237206551.1 |
Coordinates | 1068849..1069073 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM007_RS05115 (QM007_05115) | 1064125..1065276 | + | 1152 | WP_283490840.1 | hypothetical protein | - |
QM007_RS05120 (QM007_05120) | 1065336..1065788 | + | 453 | WP_283490841.1 | ribosome silencing factor | - |
QM007_RS05135 (QM007_05135) | 1066311..1066787 | + | 477 | WP_283490842.1 | DUF2975 domain-containing protein | - |
QM007_RS05140 (QM007_05140) | 1066784..1067011 | + | 228 | WP_272878551.1 | helix-turn-helix transcriptional regulator | - |
QM007_RS05145 (QM007_05145) | 1067133..1067921 | - | 789 | WP_283490843.1 | TatD family hydrolase | - |
QM007_RS05150 (QM007_05150) | 1067923..1068726 | - | 804 | WP_283490845.1 | tRNA threonylcarbamoyladenosine dehydratase | - |
QM007_RS05155 (QM007_05155) | 1068849..1069073 | + | 225 | WP_237206551.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QM007_RS05160 (QM007_05160) | 1069070..1069417 | + | 348 | WP_185174621.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QM007_RS05165 (QM007_05165) | 1070748..1071992 | + | 1245 | WP_283489550.1 | IS256 family transposase | - |
QM007_RS05170 (QM007_05170) | 1072058..1072564 | + | 507 | WP_283490846.1 | hypothetical protein | - |
QM007_RS05175 (QM007_05175) | 1072915..1073385 | - | 471 | WP_283490847.1 | DUF3817 domain-containing protein | - |
QM007_RS05180 (QM007_05180) | 1073631..1073978 | + | 348 | WP_283490848.1 | hypothetical protein | - |
QM007_RS05185 (QM007_05185) | 1074046..1074396 | + | 351 | WP_283490849.1 | DUF2200 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12897.57 Da Isoelectric Point: 6.7269
>T282485 WP_185174621.1 NZ_CP125946:1069070-1069417 [Rothia sp. SD9660Na]
MRRGDVYWVDFEPARGSEPNKKRPAIIVSRDESNTYVAHHGIGTLTVVPLTSNTRFIASFQVLLAQDETGLSTDSKAQTE
LIRTVSVDRIGDYIGTLSRNKVWELDEALKVHLNL
MRRGDVYWVDFEPARGSEPNKKRPAIIVSRDESNTYVAHHGIGTLTVVPLTSNTRFIASFQVLLAQDETGLSTDSKAQTE
LIRTVSVDRIGDYIGTLSRNKVWELDEALKVHLNL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|