Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2232764..2233293 Replicon chromosome
Accession NZ_CP125903
Organism Staphylococcus aureus strain CHAL1

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag QM337_RS11210 Protein ID WP_000621176.1
Coordinates 2232764..2233126 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag QM337_RS11215 Protein ID WP_000948331.1
Coordinates 2233123..2233293 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM337_RS11190 (2229743) 2229743..2230513 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
QM337_RS11195 (2230488) 2230488..2230967 - 480 WP_001190825.1 anti-sigma B factor RsbW -
QM337_RS11200 (2230969) 2230969..2231295 - 327 WP_001052491.1 anti-sigma factor antagonist -
QM337_RS11205 (2231414) 2231414..2232415 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
QM337_RS11210 (2232764) 2232764..2233126 - 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QM337_RS11215 (2233123) 2233123..2233293 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
QM337_RS11220 (2233378) 2233378..2234526 - 1149 WP_001281140.1 alanine racemase -
QM337_RS11225 (2234592) 2234592..2234951 - 360 WP_000581197.1 holo-ACP synthase -
QM337_RS11230 (2234955) 2234955..2235446 - 492 WP_001286801.1 PH domain-containing protein -
QM337_RS11235 (2235439) 2235439..2237016 - 1578 WP_001294646.1 PH domain-containing protein -
QM337_RS11240 (2237009) 2237009..2237488 - 480 WP_001287082.1 hypothetical protein -
QM337_RS11245 (2237697) 2237697..2238257 - 561 WP_001092414.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T282477 WP_000621176.1 NZ_CP125903:c2233126-2232764 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT282477 WP_000948331.1 NZ_CP125903:c2233293-2233123 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References