Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 854135..854612 Replicon chromosome
Accession NZ_CP125903
Organism Staphylococcus aureus strain CHAL1

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QM337_RS04060 Protein ID WP_000052076.1
Coordinates 854135..854323 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QM337_RS04065 Protein ID WP_001059690.1
Coordinates 854352..854612 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM337_RS04030 (850088) 850088..850645 + 558 WP_000824491.1 hypothetical protein -
QM337_RS04035 (850986) 850986..851672 + 687 WP_001574556.1 thermonuclease family protein -
QM337_RS04040 (852029) 852029..852229 + 201 WP_001059082.1 cold-shock protein -
QM337_RS04045 (852726) 852726..852944 - 219 WP_000005879.1 hypothetical protein -
QM337_RS04050 (853006) 853006..853290 - 285 WP_001004401.1 hypothetical protein -
QM337_RS04055 (853378) 853378..853947 - 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
QM337_RS04060 (854135) 854135..854323 - 189 WP_000052076.1 hypothetical protein Toxin
QM337_RS04065 (854352) 854352..854612 - 261 WP_001059690.1 hypothetical protein Antitoxin
QM337_RS04070 (854953) 854953..855156 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QM337_RS04075 (855153) 855153..855389 - 237 WP_000368687.1 hypothetical protein -
QM337_RS04080 (855614) 855614..856195 + 582 WP_001140696.1 histidine phosphatase family protein -
QM337_RS04085 (856268) 856268..856885 - 618 WP_000255545.1 LysE/ArgO family amino acid transporter -
QM337_RS04090 (857041) 857041..857535 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QM337_RS04095 (857934) 857934..858356 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
QM337_RS04100 (858504) 858504..859220 + 717 WP_000150036.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282467 WP_000052076.1 NZ_CP125903:c854323-854135 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282467 WP_001059690.1 NZ_CP125903:c854612-854352 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References