Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2098277..2098806 | Replicon | chromosome |
| Accession | NZ_CP125901 | ||
| Organism | Staphylococcus aureus strain CHAL2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QM338_RS10465 | Protein ID | WP_000621175.1 |
| Coordinates | 2098277..2098639 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | QM338_RS10470 | Protein ID | WP_000948331.1 |
| Coordinates | 2098636..2098806 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM338_RS10445 (2095256) | 2095256..2096026 | - | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
| QM338_RS10450 (2096001) | 2096001..2096480 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| QM338_RS10455 (2096482) | 2096482..2096808 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| QM338_RS10460 (2096927) | 2096927..2097928 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| QM338_RS10465 (2098277) | 2098277..2098639 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QM338_RS10470 (2098636) | 2098636..2098806 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QM338_RS10475 (2098891) | 2098891..2100039 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| QM338_RS10480 (2100105) | 2100105..2100464 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| QM338_RS10485 (2100468) | 2100468..2100959 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
| QM338_RS10490 (2100946) | 2100946..2102529 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| QM338_RS10495 (2102522) | 2102522..2103001 | - | 480 | WP_001287087.1 | hypothetical protein | - |
| QM338_RS10500 (2103209) | 2103209..2103769 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T282460 WP_000621175.1 NZ_CP125901:c2098639-2098277 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|