Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 827536..828013 Replicon chromosome
Accession NZ_CP125901
Organism Staphylococcus aureus strain CHAL2

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QM338_RS03970 Protein ID WP_000052076.1
Coordinates 827536..827724 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QM338_RS03975 Protein ID WP_001059690.1
Coordinates 827753..828013 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM338_RS03940 (823530) 823530..824051 + 522 WP_000824482.1 hypothetical protein -
QM338_RS03945 (824392) 824392..825078 + 687 WP_000141557.1 thermonuclease family protein -
QM338_RS03950 (825435) 825435..825635 + 201 WP_001059082.1 cold-shock protein -
QM338_RS03955 (826127) 826127..826345 - 219 WP_000005886.1 hypothetical protein -
QM338_RS03960 (826407) 826407..826691 - 285 WP_001004399.1 hypothetical protein -
QM338_RS03965 (826779) 826779..827348 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QM338_RS03970 (827536) 827536..827724 - 189 WP_000052076.1 hypothetical protein Toxin
QM338_RS03975 (827753) 827753..828013 - 261 WP_001059690.1 hypothetical protein Antitoxin
QM338_RS03980 (828354) 828354..828557 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QM338_RS03985 (828554) 828554..828790 - 237 WP_000349581.1 hypothetical protein -
QM338_RS03990 (829015) 829015..829596 + 582 WP_001140693.1 histidine phosphatase family protein -
QM338_RS03995 (829669) 829669..830286 - 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
QM338_RS04000 (830441) 830441..830935 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QM338_RS04005 (831334) 831334..831756 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QM338_RS04010 (831904) 831904..832620 + 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282454 WP_000052076.1 NZ_CP125901:c827724-827536 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282454 WP_001059690.1 NZ_CP125901:c828013-827753 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References