Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 363650..364185 | Replicon | chromosome |
Accession | NZ_CP125901 | ||
Organism | Staphylococcus aureus strain CHAL2 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | A0A4P7P340 |
Locus tag | QM338_RS01650 | Protein ID | WP_001103945.1 |
Coordinates | 363862..364185 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | - |
Locus tag | QM338_RS01645 | Protein ID | WP_001058486.1 |
Coordinates | 363650..363859 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM338_RS01605 (358701) | 358701..359204 | + | 504 | WP_000934799.1 | single-stranded DNA-binding protein | - |
QM338_RS01610 (359256) | 359256..359498 | + | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
QM338_RS01615 (359737) | 359737..360637 | - | 901 | Protein_320 | Abi family protein | - |
QM338_RS01620 (360639) | 360639..361853 | - | 1215 | WP_031765313.1 | site-specific integrase | - |
QM338_RS01625 (362117) | 362117..362842 | - | 726 | WP_000668215.1 | helix-turn-helix transcriptional regulator | - |
QM338_RS01630 (363014) | 363014..363226 | + | 213 | WP_001245562.1 | helix-turn-helix transcriptional regulator | - |
QM338_RS01635 (363227) | 363227..363499 | + | 273 | WP_001138300.1 | helix-turn-helix domain-containing protein | - |
QM338_RS01640 (363511) | 363511..363657 | + | 147 | WP_000784875.1 | hypothetical protein | - |
QM338_RS01645 (363650) | 363650..363859 | + | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
QM338_RS01650 (363862) | 363862..364185 | + | 324 | WP_001103945.1 | DUF1474 family protein | Toxin |
QM338_RS01655 (364250) | 364250..365119 | + | 870 | WP_031765319.1 | primase alpha helix C-terminal domain-containing protein | - |
QM338_RS01660 (365136) | 365136..366593 | + | 1458 | WP_031765320.1 | virulence-associated E family protein | - |
QM338_RS01665 (366894) | 366894..367256 | + | 363 | WP_031765322.1 | hypothetical protein | - |
QM338_RS01670 (367258) | 367258..367542 | + | 285 | WP_000998179.1 | hypothetical protein | - |
QM338_RS01675 (367539) | 367539..368180 | + | 642 | WP_031765326.1 | pathogenicity island protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | tsst-1 | 358701..377563 | 18862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12665.26 Da Isoelectric Point: 4.7124
>T282453 WP_001103945.1 NZ_CP125901:363862-364185 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|