Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2062516..2063045 | Replicon | chromosome |
| Accession | NZ_CP125899 | ||
| Organism | Staphylococcus aureus strain CHAL3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QM339_RS10205 | Protein ID | WP_000621175.1 |
| Coordinates | 2062516..2062878 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | QM339_RS10210 | Protein ID | WP_000948331.1 |
| Coordinates | 2062875..2063045 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM339_RS10185 (2059495) | 2059495..2060265 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| QM339_RS10190 (2060240) | 2060240..2060719 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| QM339_RS10195 (2060721) | 2060721..2061047 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| QM339_RS10200 (2061166) | 2061166..2062167 | - | 1002 | WP_283502257.1 | PP2C family protein-serine/threonine phosphatase | - |
| QM339_RS10205 (2062516) | 2062516..2062878 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QM339_RS10210 (2062875) | 2062875..2063045 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QM339_RS10215 (2063130) | 2063130..2064278 | - | 1149 | WP_001281140.1 | alanine racemase | - |
| QM339_RS10220 (2064344) | 2064344..2064703 | - | 360 | WP_000581199.1 | holo-ACP synthase | - |
| QM339_RS10225 (2064707) | 2064707..2065198 | - | 492 | WP_001205907.1 | PH domain-containing protein | - |
| QM339_RS10230 (2065185) | 2065185..2066768 | - | 1584 | WP_001294637.1 | PH domain-containing protein | - |
| QM339_RS10235 (2066761) | 2066761..2067240 | - | 480 | WP_001287077.1 | hypothetical protein | - |
| QM339_RS10240 (2067448) | 2067448..2068008 | - | 561 | WP_001092406.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T282450 WP_000621175.1 NZ_CP125899:c2062878-2062516 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|