282449

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1970135..1970612 Replicon chromosome
Accession NZ_CP125899
Organism Staphylococcus aureus strain CHAL3

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QM339_RS09695 Protein ID WP_000052076.1
Coordinates 1970424..1970612 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QM339_RS09690 Protein ID WP_001059690.1
Coordinates 1970135..1970395 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM339_RS09655 (1965529) 1965529..1966245 - 717 WP_000150033.1 type I 3-dehydroquinate dehydratase -
QM339_RS09660 (1966393) 1966393..1966815 + 423 WP_000974451.1 organic hydroperoxide resistance protein -
QM339_RS09665 (1967213) 1967213..1967707 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
QM339_RS09670 (1967863) 1967863..1968480 + 618 WP_000255550.1 LysE/ArgO family amino acid transporter -
QM339_RS09675 (1968553) 1968553..1969134 - 582 WP_001140696.1 histidine phosphatase family protein -
QM339_RS09680 (1969358) 1969358..1969594 + 237 WP_000377079.1 hypothetical protein -
QM339_RS09685 (1969591) 1969591..1969794 - 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
QM339_RS09690 (1970135) 1970135..1970395 + 261 WP_001059690.1 hypothetical protein Antitoxin
QM339_RS09695 (1970424) 1970424..1970612 + 189 WP_000052076.1 hypothetical protein Toxin
QM339_RS09700 (1970800) 1970800..1971369 + 570 WP_001106662.1 lipoprotein N-acylation protein LnsA -
QM339_RS09705 (1971457) 1971457..1971729 + 273 WP_001004400.1 hypothetical protein -
QM339_RS09710 (1971802) 1971802..1972020 + 219 WP_000005884.1 hypothetical protein -
QM339_RS09715 (1972517) 1972517..1972717 - 201 WP_001059082.1 cold-shock protein -
QM339_RS09720 (1973074) 1973074..1973760 - 687 WP_001622483.1 thermonuclease family protein -
QM339_RS09725 (1974101) 1974101..1974622 - 522 WP_000824479.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp / sell / sec / hlb / groEL 1967213..2014837 47624


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282449 WP_000052076.1 NZ_CP125899:1970424-1970612 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282449 WP_001059690.1 NZ_CP125899:1970135-1970395 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References