Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 938562..939338 | Replicon | chromosome |
| Accession | NZ_CP125899 | ||
| Organism | Staphylococcus aureus strain CHAL3 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | QM339_RS04720 | Protein ID | WP_000031109.1 |
| Coordinates | 939186..939338 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | QM339_RS04715 | Protein ID | WP_001251224.1 |
| Coordinates | 938562..939161 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM339_RS04695 (934478) | 934478..935935 | + | 1458 | WP_000649916.1 | ABC transporter permease subunit | - |
| QM339_RS04700 (935928) | 935928..936650 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| QM339_RS04705 (936801) | 936801..937928 | + | 1128 | Protein_885 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QM339_RS04710 (937933) | 937933..938403 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QM339_RS04715 (938562) | 938562..939161 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QM339_RS04720 (939186) | 939186..939338 | + | 153 | WP_000031109.1 | SAS053 family protein | Toxin |
| QM339_RS04725 (940337) | 940337..940732 | + | 396 | WP_000901019.1 | hypothetical protein | - |
| QM339_RS04730 (940928) | 940928..942313 | + | 1386 | WP_000116239.1 | class II fumarate hydratase | - |
| QM339_RS04735 (942770) | 942770..943591 | - | 822 | WP_000669377.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5950.31 Da Isoelectric Point: 3.9075
>T282448 WP_000031109.1 NZ_CP125899:939186-939338 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEESQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT282448 WP_001251224.1 NZ_CP125899:938562-939161 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|