Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 806004..806533 | Replicon | chromosome |
Accession | NZ_CP125899 | ||
Organism | Staphylococcus aureus strain CHAL3 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | K7ZRX6 |
Locus tag | QM339_RS03845 | Protein ID | WP_001103939.1 |
Coordinates | 806216..806533 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | X5IY59 |
Locus tag | QM339_RS03840 | Protein ID | WP_001058494.1 |
Coordinates | 806004..806213 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM339_RS03805 (802334) | 802334..802798 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
QM339_RS03815 (803361) | 803361..804467 | - | 1107 | WP_000149511.1 | tyrosine-type recombinase/integrase | - |
QM339_RS03820 (804457) | 804457..805260 | - | 804 | WP_000358990.1 | helix-turn-helix transcriptional regulator | - |
QM339_RS03825 (805397) | 805397..805621 | + | 225 | WP_049304875.1 | transcriptional regulator | - |
QM339_RS03830 (805635) | 805635..805853 | + | 219 | WP_000163544.1 | helix-turn-helix transcriptional regulator | - |
QM339_RS03835 (805865) | 805865..806011 | + | 147 | WP_000784885.1 | hypothetical protein | - |
QM339_RS03840 (806004) | 806004..806213 | + | 210 | WP_001058494.1 | hypothetical protein | Antitoxin |
QM339_RS03845 (806216) | 806216..806533 | + | 318 | WP_001103939.1 | DUF1474 family protein | Toxin |
QM339_RS03850 (806597) | 806597..807466 | + | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
QM339_RS03855 (807483) | 807483..808940 | + | 1458 | WP_000390453.1 | virulence-associated E family protein | - |
QM339_RS03865 (810467) | 810467..810829 | + | 363 | WP_001039170.1 | hypothetical protein | - |
QM339_RS03870 (810831) | 810831..811115 | + | 285 | WP_000998185.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / chp / scn | 803361..842992 | 39631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12547.17 Da Isoelectric Point: 5.0161
>T282443 WP_001103939.1 NZ_CP125899:806216-806533 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|