Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1920272..1921048 | Replicon | chromosome |
Accession | NZ_CP125897 | ||
Organism | Staphylococcus aureus strain CHAL4 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | QM341_RS09425 | Protein ID | WP_000031108.1 |
Coordinates | 1920272..1920424 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | QM341_RS09430 | Protein ID | WP_001251224.1 |
Coordinates | 1920449..1921048 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM341_RS09410 (1916235) | 1916235..1917056 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
QM341_RS09415 (1917519) | 1917519..1918904 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
QM341_RS09420 (1919100) | 1919100..1919495 | - | 396 | WP_000901021.1 | hypothetical protein | - |
QM341_RS09425 (1920272) | 1920272..1920424 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
QM341_RS09430 (1920449) | 1920449..1921048 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QM341_RS09435 (1921207) | 1921207..1921677 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QM341_RS09440 (1921682) | 1921682..1922809 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QM341_RS09445 (1922960) | 1922960..1923682 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
QM341_RS09450 (1923675) | 1923675..1925132 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T282433 WP_000031108.1 NZ_CP125897:c1920424-1920272 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT282433 WP_001251224.1 NZ_CP125897:c1921048-1920449 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|