Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 856789..857266 Replicon chromosome
Accession NZ_CP125897
Organism Staphylococcus aureus strain CHAL4

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag QM341_RS04265 Protein ID WP_000052078.1
Coordinates 856789..856977 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QM341_RS04270 Protein ID WP_001059690.1
Coordinates 857006..857266 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM341_RS04235 (852830) 852830..853300 + 471 WP_000824472.1 hypothetical protein -
QM341_RS04240 (853641) 853641..854327 + 687 WP_001548082.1 thermonuclease family protein -
QM341_RS04245 (854684) 854684..854884 + 201 WP_001059082.1 cold-shock protein -
QM341_RS04250 (855380) 855380..855598 - 219 WP_000005886.1 hypothetical protein -
QM341_RS04255 (855660) 855660..855944 - 285 WP_001004395.1 hypothetical protein -
QM341_RS04260 (856032) 856032..856601 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QM341_RS04265 (856789) 856789..856977 - 189 WP_000052078.1 hypothetical protein Toxin
QM341_RS04270 (857006) 857006..857266 - 261 WP_001059690.1 hypothetical protein Antitoxin
QM341_RS04275 (857607) 857607..857810 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QM341_RS04280 (857807) 857807..858043 - 237 WP_000368687.1 hypothetical protein -
QM341_RS04285 (858268) 858268..858849 + 582 WP_001140686.1 histidine phosphatase family protein -
QM341_RS04290 (858922) 858922..859539 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
QM341_RS04295 (859694) 859694..860188 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QM341_RS04300 (860587) 860587..861009 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QM341_RS04305 (861157) 861157..861873 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 851473..885065 33592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T282431 WP_000052078.1 NZ_CP125897:c856977-856789 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282431 WP_001059690.1 NZ_CP125897:c857266-857006 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References