Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2068087..2068616 | Replicon | chromosome |
Accession | NZ_CP125895 | ||
Organism | Staphylococcus aureus strain CHAL5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QM342_RS10170 | Protein ID | WP_000621175.1 |
Coordinates | 2068087..2068449 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | QM342_RS10175 | Protein ID | WP_000948331.1 |
Coordinates | 2068446..2068616 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM342_RS10150 (2065066) | 2065066..2065836 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
QM342_RS10155 (2065811) | 2065811..2066290 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
QM342_RS10160 (2066292) | 2066292..2066618 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
QM342_RS10165 (2066737) | 2066737..2067738 | - | 1002 | WP_061839378.1 | PP2C family protein-serine/threonine phosphatase | - |
QM342_RS10170 (2068087) | 2068087..2068449 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QM342_RS10175 (2068446) | 2068446..2068616 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QM342_RS10180 (2068701) | 2068701..2069849 | - | 1149 | WP_001281151.1 | alanine racemase | - |
QM342_RS10185 (2069915) | 2069915..2070274 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
QM342_RS10190 (2070278) | 2070278..2070769 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
QM342_RS10195 (2070756) | 2070756..2072339 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
QM342_RS10200 (2072332) | 2072332..2072811 | - | 480 | WP_001287090.1 | hypothetical protein | - |
QM342_RS10205 (2073020) | 2073020..2073580 | - | 561 | WP_001092416.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T282422 WP_000621175.1 NZ_CP125895:c2068449-2068087 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|