Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 824057..824534 Replicon chromosome
Accession NZ_CP125895
Organism Staphylococcus aureus strain CHAL5

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag QM342_RS03925 Protein ID WP_000052076.1
Coordinates 824057..824245 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QM342_RS03930 Protein ID WP_001059690.1
Coordinates 824274..824534 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM342_RS03895 (820060) 820060..820569 + 510 WP_000824480.1 hypothetical protein -
QM342_RS03900 (820910) 820910..821596 + 687 WP_001641381.1 thermonuclease family protein -
QM342_RS03905 (821953) 821953..822153 + 201 WP_001059082.1 cold-shock protein -
QM342_RS03910 (822648) 822648..822866 - 219 WP_000005889.1 hypothetical protein -
QM342_RS03915 (822928) 822928..823212 - 285 WP_001004395.1 hypothetical protein -
QM342_RS03920 (823300) 823300..823869 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QM342_RS03925 (824057) 824057..824245 - 189 WP_000052076.1 hypothetical protein Toxin
QM342_RS03930 (824274) 824274..824534 - 261 WP_001059690.1 hypothetical protein Antitoxin
QM342_RS03935 (824874) 824874..825077 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QM342_RS03940 (825074) 825074..825310 - 237 WP_000368687.1 hypothetical protein -
QM342_RS03945 (825535) 825535..826116 + 582 WP_001140690.1 histidine phosphatase family protein -
QM342_RS03950 (826189) 826189..826806 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
QM342_RS03955 (826960) 826960..827454 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QM342_RS03960 (827853) 827853..828275 - 423 WP_000974447.1 organic hydroperoxide resistance protein -
QM342_RS03965 (828423) 828423..829139 + 717 WP_000150021.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T282417 WP_000052076.1 NZ_CP125895:c824245-824057 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT282417 WP_001059690.1 NZ_CP125895:c824534-824274 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References