Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 413298..413953 | Replicon | chromosome |
| Accession | NZ_CP125880 | ||
| Organism | Auritidibacter ignavus strain BABAE-7 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QM403_RS01870 | Protein ID | WP_110100005.1 |
| Coordinates | 413298..413723 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QM403_RS01875 | Protein ID | WP_110100006.1 |
| Coordinates | 413720..413953 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM403_RS01835 (QM403_01835) | 408938..409702 | - | 765 | WP_283518357.1 | sulfite exporter TauE/SafE family protein | - |
| QM403_RS01840 (QM403_01840) | 409968..410342 | - | 375 | WP_283532858.1 | hypothetical protein | - |
| QM403_RS01845 (QM403_01845) | 410327..410560 | - | 234 | WP_283532859.1 | hypothetical protein | - |
| QM403_RS01850 (QM403_01850) | 410711..411016 | - | 306 | WP_283533073.1 | helix-turn-helix transcriptional regulator | - |
| QM403_RS01855 (QM403_01855) | 411022..411213 | - | 192 | WP_233487799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QM403_RS01860 (QM403_01860) | 411480..412205 | - | 726 | WP_283532860.1 | hypothetical protein | - |
| QM403_RS01865 (QM403_01865) | 412749..413285 | - | 537 | WP_283532861.1 | GNAT family N-acetyltransferase | - |
| QM403_RS01870 (QM403_01870) | 413298..413723 | - | 426 | WP_110100005.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QM403_RS01875 (QM403_01875) | 413720..413953 | - | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
| QM403_RS01880 (QM403_01880) | 414101..415186 | - | 1086 | WP_283532862.1 | redox-regulated ATPase YchF | - |
| QM403_RS01885 (QM403_01885) | 415481..417688 | + | 2208 | WP_283532863.1 | choline BCCT transporter BetT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15267.47 Da Isoelectric Point: 5.2123
>T282416 WP_110100005.1 NZ_CP125880:c413723-413298 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|