Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 336691..337346 | Replicon | chromosome |
| Accession | NZ_CP125879 | ||
| Organism | Auritidibacter ignavus strain BABAE-8 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QM395_RS01460 | Protein ID | WP_110100005.1 |
| Coordinates | 336691..337116 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QM395_RS01465 | Protein ID | WP_110100006.1 |
| Coordinates | 337113..337346 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM395_RS01420 (QM395_01420) | 332330..333094 | - | 765 | WP_283518357.1 | sulfite exporter TauE/SafE family protein | - |
| QM395_RS01425 (QM395_01425) | 333360..333734 | - | 375 | WP_283518359.1 | hypothetical protein | - |
| QM395_RS01430 (QM395_01430) | 333719..334003 | - | 285 | WP_283518361.1 | hypothetical protein | - |
| QM395_RS01435 (QM395_01435) | 334103..334408 | - | 306 | WP_110100035.1 | helix-turn-helix transcriptional regulator | - |
| QM395_RS01440 (QM395_01440) | 334414..334605 | - | 192 | WP_233242926.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QM395_RS01445 (QM395_01445) | 334872..335597 | - | 726 | WP_283518363.1 | hypothetical protein | - |
| QM395_RS01450 (QM395_01450) | 336141..336389 | - | 249 | WP_283518365.1 | hypothetical protein | - |
| QM395_RS01455 (QM395_01455) | 336394..336678 | - | 285 | WP_283518367.1 | hypothetical protein | - |
| QM395_RS01460 (QM395_01460) | 336691..337116 | - | 426 | WP_110100005.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QM395_RS01465 (QM395_01465) | 337113..337346 | - | 234 | WP_110100006.1 | Arc family DNA-binding protein | Antitoxin |
| QM395_RS01470 (QM395_01470) | 337494..338579 | - | 1086 | WP_283518370.1 | redox-regulated ATPase YchF | - |
| QM395_RS01475 (QM395_01475) | 338874..341081 | + | 2208 | WP_283518372.1 | choline BCCT transporter BetT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15267.47 Da Isoelectric Point: 5.2123
>T282414 WP_110100005.1 NZ_CP125879:c337116-336691 [Auritidibacter ignavus]
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
VIILDTNVISEIFRPLPEPRVADWLTSLEGDVAITSVTLAELLAGLRRLPDGRRRDALTRRIDVALAPYRGGRAVLPFDD
VAADRYADVLVARERAGAPISTADAQIAAICLAHGATCATRNVKDFQHTGVELVDPWKVDA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|