Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 828286..828814 Replicon chromosome
Accession NZ_CP125857
Organism Vibrio parahaemolyticus strain G855

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QMY43_RS19805 Protein ID WP_108653690.1
Coordinates 828286..828576 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QMY43_RS19810 Protein ID WP_025611568.1
Coordinates 828566..828814 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMY43_RS19770 (QMY43_19770) 824185..825177 + 993 WP_108654759.1 hypothetical protein -
QMY43_RS19775 (QMY43_19775) 825283..825750 + 468 WP_108654760.1 NUDIX domain-containing protein -
QMY43_RS19780 (QMY43_19780) 825725..825874 + 150 WP_108654761.1 DUF3265 domain-containing protein -
QMY43_RS19785 (QMY43_19785) 826340..827308 - 969 WP_159404068.1 IS30-like element ISVa6 family transposase -
QMY43_RS19790 (QMY43_19790) 827423..827515 + 93 WP_140321407.1 DUF3265 domain-containing protein -
QMY43_RS19795 (QMY43_19795) 827617..827871 + 255 WP_029865959.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
QMY43_RS19800 (QMY43_19800) 827864..828133 + 270 WP_029865924.1 Txe/YoeB family addiction module toxin -
QMY43_RS19805 (QMY43_19805) 828286..828576 - 291 WP_108653690.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QMY43_RS19810 (QMY43_19810) 828566..828814 - 249 WP_025611568.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QMY43_RS19815 (QMY43_19815) 828889..828957 + 69 WP_080254664.1 DUF3265 domain-containing protein -
QMY43_RS19820 (QMY43_19820) 829055..829561 + 507 WP_229607483.1 ClbS/DfsB family four-helix bundle protein -
QMY43_RS19825 (QMY43_19825) 829679..830167 + 489 WP_108653692.1 DUF523 domain-containing protein -
QMY43_RS19830 (QMY43_19830) 830371..831252 - 882 WP_108653693.1 LysR family transcriptional regulator -
QMY43_RS19835 (QMY43_19835) 831356..832294 + 939 WP_031428077.1 DMT family transporter -
QMY43_RS19840 (QMY43_19840) 832638..833003 - 366 WP_031428075.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 816178..863821 47643
- flank IS/Tn - - 826340..827116 776


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11300.24 Da        Isoelectric Point: 10.5339

>T282411 WP_108653690.1 NZ_CP125857:c828576-828286 [Vibrio parahaemolyticus]
MTYRLDFKKSALKEWKKLGSTLQQQFKKKLIDRLDNPHVPASKLSGTDNMYKIKLRQSGYRLVYKVEDDVIIVTILAVGK
HERSDVYRKAMKRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9109.39 Da        Isoelectric Point: 3.9610

>AT282411 WP_025611568.1 NZ_CP125857:c828814-828566 [Vibrio parahaemolyticus]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAETYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References