Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 828286..828814 | Replicon | chromosome |
| Accession | NZ_CP125857 | ||
| Organism | Vibrio parahaemolyticus strain G855 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QMY43_RS19805 | Protein ID | WP_108653690.1 |
| Coordinates | 828286..828576 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QMY43_RS19810 | Protein ID | WP_025611568.1 |
| Coordinates | 828566..828814 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMY43_RS19770 (QMY43_19770) | 824185..825177 | + | 993 | WP_108654759.1 | hypothetical protein | - |
| QMY43_RS19775 (QMY43_19775) | 825283..825750 | + | 468 | WP_108654760.1 | NUDIX domain-containing protein | - |
| QMY43_RS19780 (QMY43_19780) | 825725..825874 | + | 150 | WP_108654761.1 | DUF3265 domain-containing protein | - |
| QMY43_RS19785 (QMY43_19785) | 826340..827308 | - | 969 | WP_159404068.1 | IS30-like element ISVa6 family transposase | - |
| QMY43_RS19790 (QMY43_19790) | 827423..827515 | + | 93 | WP_140321407.1 | DUF3265 domain-containing protein | - |
| QMY43_RS19795 (QMY43_19795) | 827617..827871 | + | 255 | WP_029865959.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| QMY43_RS19800 (QMY43_19800) | 827864..828133 | + | 270 | WP_029865924.1 | Txe/YoeB family addiction module toxin | - |
| QMY43_RS19805 (QMY43_19805) | 828286..828576 | - | 291 | WP_108653690.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMY43_RS19810 (QMY43_19810) | 828566..828814 | - | 249 | WP_025611568.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QMY43_RS19815 (QMY43_19815) | 828889..828957 | + | 69 | WP_080254664.1 | DUF3265 domain-containing protein | - |
| QMY43_RS19820 (QMY43_19820) | 829055..829561 | + | 507 | WP_229607483.1 | ClbS/DfsB family four-helix bundle protein | - |
| QMY43_RS19825 (QMY43_19825) | 829679..830167 | + | 489 | WP_108653692.1 | DUF523 domain-containing protein | - |
| QMY43_RS19830 (QMY43_19830) | 830371..831252 | - | 882 | WP_108653693.1 | LysR family transcriptional regulator | - |
| QMY43_RS19835 (QMY43_19835) | 831356..832294 | + | 939 | WP_031428077.1 | DMT family transporter | - |
| QMY43_RS19840 (QMY43_19840) | 832638..833003 | - | 366 | WP_031428075.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 816178..863821 | 47643 | |
| - | flank | IS/Tn | - | - | 826340..827116 | 776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11300.24 Da Isoelectric Point: 10.5339
>T282411 WP_108653690.1 NZ_CP125857:c828576-828286 [Vibrio parahaemolyticus]
MTYRLDFKKSALKEWKKLGSTLQQQFKKKLIDRLDNPHVPASKLSGTDNMYKIKLRQSGYRLVYKVEDDVIIVTILAVGK
HERSDVYRKAMKRLDD
MTYRLDFKKSALKEWKKLGSTLQQQFKKKLIDRLDNPHVPASKLSGTDNMYKIKLRQSGYRLVYKVEDDVIIVTILAVGK
HERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|