Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 1056412..1056961 | Replicon | chromosome |
| Accession | NZ_CP125856 | ||
| Organism | Vibrio parahaemolyticus strain G855 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QMY43_RS05200 | Protein ID | WP_159404083.1 |
| Coordinates | 1056412..1056711 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A347UQT2 |
| Locus tag | QMY43_RS05205 | Protein ID | WP_005442033.1 |
| Coordinates | 1056719..1056961 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMY43_RS05170 (QMY43_05170) | 1051997..1052644 | + | 648 | WP_159404077.1 | glutathione S-transferase | - |
| QMY43_RS05175 (QMY43_05175) | 1052812..1053309 | + | 498 | WP_159404078.1 | DinB family protein | - |
| QMY43_RS05180 (QMY43_05180) | 1053474..1054241 | + | 768 | WP_159404079.1 | FRG domain-containing protein | - |
| QMY43_RS05185 (QMY43_05185) | 1054761..1054898 | + | 138 | WP_236578045.1 | DUF3265 domain-containing protein | - |
| QMY43_RS05190 (QMY43_05190) | 1054925..1055545 | + | 621 | WP_159404081.1 | hypothetical protein | - |
| QMY43_RS05195 (QMY43_05195) | 1055699..1056241 | + | 543 | WP_193237468.1 | GNAT family N-acetyltransferase | - |
| QMY43_RS05200 (QMY43_05200) | 1056412..1056711 | - | 300 | WP_159404083.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMY43_RS05205 (QMY43_05205) | 1056719..1056961 | - | 243 | WP_005442033.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QMY43_RS05210 (QMY43_05210) | 1057036..1057110 | + | 75 | Protein_990 | DUF3265 domain-containing protein | - |
| QMY43_RS05215 (QMY43_05215) | 1057201..1057713 | + | 513 | WP_159404084.1 | hypothetical protein | - |
| QMY43_RS05220 (QMY43_05220) | 1057738..1057830 | + | 93 | WP_079877499.1 | DUF3265 domain-containing protein | - |
| QMY43_RS05225 (QMY43_05225) | 1058292..1058372 | + | 81 | Protein_993 | DUF3265 domain-containing protein | - |
| QMY43_RS05230 (QMY43_05230) | 1058468..1058899 | - | 432 | WP_043038654.1 | hypothetical protein | - |
| QMY43_RS05235 (QMY43_05235) | 1059670..1060005 | + | 336 | WP_283277507.1 | hypothetical protein | - |
| QMY43_RS05240 (QMY43_05240) | 1060158..1060691 | + | 534 | WP_140104155.1 | hypothetical protein | - |
| QMY43_RS05245 (QMY43_05245) | 1060827..1061594 | + | 768 | WP_159404085.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1016992..1072268 | 55276 | |
| - | flank | IS/Tn | - | - | 1050775..1051551 | 776 | |
| - | inside | Integron | - | - | 1044626..1077704 | 33078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11543.16 Da Isoelectric Point: 8.0336
>T282408 WP_159404083.1 NZ_CP125856:c1056711-1056412 [Vibrio parahaemolyticus]
MQKNKYKLSNLAQSHLRKVKDYTVENFSELQWRNYKDTLLSGFQMLADNPDLGRSCDEIYPNGFFFPIGKHTAYFIKEDD
FILVVGVLGQSQLPQNHLK
MQKNKYKLSNLAQSHLRKVKDYTVENFSELQWRNYKDTLLSGFQMLADNPDLGRSCDEIYPNGFFFPIGKHTAYFIKEDD
FILVVGVLGQSQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|