Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1570096..1570697 | Replicon | chromosome |
| Accession | NZ_CP125806 | ||
| Organism | Pasteurella multocida strain P030653/2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QM029_RS07560 | Protein ID | WP_078819687.1 |
| Coordinates | 1570096..1570410 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QM029_RS07565 | Protein ID | WP_078819686.1 |
| Coordinates | 1570407..1570697 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM029_RS07520 (QM029_07520) | 1565321..1565689 | - | 369 | Protein_1444 | Bro-N domain-containing protein | - |
| QM029_RS07525 (QM029_07525) | 1566093..1566749 | - | 657 | WP_014390711.1 | Bro-N domain-containing protein | - |
| QM029_RS07530 (QM029_07530) | 1567034..1567870 | - | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| QM029_RS07535 (QM029_07535) | 1567981..1568358 | - | 378 | WP_014390713.1 | hypothetical protein | - |
| QM029_RS07540 (QM029_07540) | 1568333..1568524 | - | 192 | WP_014390714.1 | hypothetical protein | - |
| QM029_RS07555 (QM029_07555) | 1569411..1569638 | - | 228 | WP_099821843.1 | hypothetical protein | - |
| QM029_RS07560 (QM029_07560) | 1570096..1570410 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM029_RS07565 (QM029_07565) | 1570407..1570697 | + | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| QM029_RS07570 (QM029_07570) | 1570723..1571160 | - | 438 | WP_078819883.1 | hypothetical protein | - |
| QM029_RS07575 (QM029_07575) | 1571157..1573001 | - | 1845 | WP_265362803.1 | DEAD/DEAH box helicase family protein | - |
| QM029_RS07580 (QM029_07580) | 1573212..1573889 | - | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| QM029_RS07585 (QM029_07585) | 1574013..1574210 | + | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| QM029_RS07590 (QM029_07590) | 1574260..1574712 | + | 453 | WP_014390720.1 | hypothetical protein | - |
| QM029_RS07595 (QM029_07595) | 1574771..1575472 | + | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1546021..1599815 | 53794 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T282405 WP_078819687.1 NZ_CP125806:1570096-1570410 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|