Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 968000..968574 | Replicon | chromosome |
| Accession | NZ_CP125806 | ||
| Organism | Pasteurella multocida strain P030653/2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A849CFF7 |
| Locus tag | QM029_RS04745 | Protein ID | WP_014667974.1 |
| Coordinates | 968290..968574 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A849CG04 |
| Locus tag | QM029_RS04740 | Protein ID | WP_014391174.1 |
| Coordinates | 968000..968293 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM029_RS04720 (QM029_04720) | 963166..964257 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
| QM029_RS04725 (QM029_04725) | 964606..966396 | + | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
| QM029_RS04730 (QM029_04730) | 966441..966908 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
| QM029_RS04735 (QM029_04735) | 966926..967603 | + | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| QM029_RS04740 (QM029_04740) | 968000..968293 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
| QM029_RS04745 (QM029_04745) | 968290..968574 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
| QM029_RS04755 (QM029_04755) | 969868..970129 | - | 262 | Protein_904 | hypothetical protein | - |
| QM029_RS04760 (QM029_04760) | 970473..970625 | - | 153 | WP_014391177.1 | hypothetical protein | - |
| QM029_RS04765 (QM029_04765) | 970925..973111 | - | 2187 | WP_014667973.1 | S8 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 969868..970029 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T282404 WP_014667974.1 NZ_CP125806:c968574-968290 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CFF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CG04 |