Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 54084..54681 Replicon chromosome
Accession NZ_CP125806
Organism Pasteurella multocida strain P030653/2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QM029_RS00365 Protein ID WP_078802155.1
Coordinates 54084..54383 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QM029_RS00370 Protein ID WP_078802156.1
Coordinates 54385..54681 (+) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM029_RS00325 (QM029_00325) 49339..49569 + 231 WP_223251317.1 hypothetical protein -
QM029_RS00330 (QM029_00330) 49631..50272 - 642 WP_170376553.1 Bro-N domain-containing protein -
QM029_RS00335 (QM029_00335) 50527..50790 - 264 WP_071522857.1 hypothetical protein -
QM029_RS00340 (QM029_00340) 51009..51389 - 381 WP_075271374.1 type II toxin-antitoxin system PemK/MazF family toxin -
QM029_RS00345 (QM029_00345) 51567..51839 + 273 WP_014391457.1 hypothetical protein -
QM029_RS00350 (QM029_00350) 51832..52020 - 189 WP_014391458.1 hypothetical protein -
QM029_RS00360 (QM029_00360) 53606..53803 - 198 WP_250274084.1 hypothetical protein -
QM029_RS00365 (QM029_00365) 54084..54383 + 300 WP_078802155.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QM029_RS00370 (QM029_00370) 54385..54681 + 297 WP_078802156.1 putative addiction module antidote protein Antitoxin
QM029_RS00375 (QM029_00375) 54775..55431 - 657 WP_078802157.1 XRE family transcriptional regulator -
QM029_RS00380 (QM029_00380) 55562..55768 + 207 WP_250274086.1 helix-turn-helix transcriptional regulator -
QM029_RS00385 (QM029_00385) 55818..56270 + 453 WP_101750067.1 hypothetical protein -
QM029_RS00390 (QM029_00390) 56322..57005 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
QM029_RS00395 (QM029_00395) 57002..57355 + 354 WP_014390722.1 HNH endonuclease signature motif containing protein -
QM029_RS00400 (QM029_00400) 57357..58256 + 900 WP_014390723.1 hypothetical protein -
QM029_RS00405 (QM029_00405) 58256..58951 + 696 WP_283341484.1 replication protein P -
QM029_RS00410 (QM029_00410) 58944..59474 + 531 WP_170356878.1 MT-A70 family methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - htpB 39830..144863 105033


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-98)

Antitoxin

Uncharacterized protein HI1420

(4-90)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11415.35 Da        Isoelectric Point: 10.6963

>T282403 WP_078802155.1 NZ_CP125806:54084-54383 [Pasteurella multocida]
MTIRIKTTERFDSWLRKLKNPRAKMKINARIKRLQFGNFGDLKTVNDGIFEMRIDEGQGYRIYLKNNNSVVVILLCGGDK
STQNKDIKLAKQIAEELGV

Download         Length: 300 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 11054.67 Da        Isoelectric Point: 4.8668

>AT282403 WP_078802156.1 NZ_CP125806:54385-54681 [Pasteurella multocida]
MEQLKDFDIAEHLTTEEEIRLYLNEILQEDNIELILSALGDIARARNISQISRETGISREGLYKALSGKGNPTFATVLKV
MKALNLQFEVKVNNVIHA

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References