Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 711977..712608 | Replicon | chromosome |
Accession | NZ_CP125805 | ||
Organism | Mannheimia bovis strain 39324.S-11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QMO40_RS03600 | Protein ID | WP_283386768.1 |
Coordinates | 712210..712608 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | W0QAN9 |
Locus tag | QMO40_RS03595 | Protein ID | WP_025236825.1 |
Coordinates | 711977..712210 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO40_RS03565 (QMO40_03565) | 707091..707408 | - | 318 | WP_025236829.1 | hypothetical protein | - |
QMO40_RS03570 (QMO40_03570) | 707405..708613 | - | 1209 | WP_283386765.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
QMO40_RS03575 (QMO40_03575) | 708771..709469 | + | 699 | WP_283386766.1 | DNA repair protein RadC | - |
QMO40_RS03580 (QMO40_03580) | 709731..709967 | + | 237 | WP_006251446.1 | 50S ribosomal protein L28 | - |
QMO40_RS03585 (QMO40_03585) | 709979..710149 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
QMO40_RS03590 (QMO40_03590) | 710460..711824 | + | 1365 | WP_283386767.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
QMO40_RS03595 (QMO40_03595) | 711977..712210 | + | 234 | WP_025236825.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QMO40_RS03600 (QMO40_03600) | 712210..712608 | + | 399 | WP_283386768.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QMO40_RS03605 (QMO40_03605) | 712628..714163 | + | 1536 | WP_283386769.1 | L-2,4-diaminobutyrate decarboxylase | - |
QMO40_RS03610 (QMO40_03610) | 714252..714824 | - | 573 | WP_283386770.1 | NAD(P)H-dependent oxidoreductase | - |
QMO40_RS03615 (QMO40_03615) | 714998..715531 | + | 534 | WP_283387070.1 | ferredoxin-type protein NapF | - |
QMO40_RS03620 (QMO40_03620) | 715528..715794 | + | 267 | WP_025236820.1 | chaperone NapD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15102.52 Da Isoelectric Point: 8.8588
>T282401 WP_283386768.1 NZ_CP125805:712210-712608 [Mannheimia bovis]
MLKYMLDTNIVIYIIKRRPIEVLHRFNQNAGRMCVSSITAAELYYGAEKSEFPTRNLAIIEDFLSRLTILDYQLKSAAHF
GNIKANLAKQGKLIGENDIHIAAHARSEGLIVVTNNLKEFERVEGLRLENWI
MLKYMLDTNIVIYIIKRRPIEVLHRFNQNAGRMCVSSITAAELYYGAEKSEFPTRNLAIIEDFLSRLTILDYQLKSAAHF
GNIKANLAKQGKLIGENDIHIAAHARSEGLIVVTNNLKEFERVEGLRLENWI
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|