Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 312517..313157 | Replicon | chromosome |
Accession | NZ_CP125805 | ||
Organism | Mannheimia bovis strain 39324.S-11 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | QMO40_RS01510 | Protein ID | WP_283386521.1 |
Coordinates | 312517..312921 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | QMO40_RS01515 | Protein ID | WP_283386522.1 |
Coordinates | 312918..313157 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO40_RS01495 (QMO40_01495) | 311108..311410 | - | 303 | WP_283386519.1 | hypothetical protein | - |
QMO40_RS01500 (QMO40_01500) | 311422..311862 | - | 441 | WP_283386520.1 | hypothetical protein | - |
QMO40_RS01505 (QMO40_01505) | 312077..312337 | + | 261 | WP_176807923.1 | helix-turn-helix transcriptional regulator | - |
QMO40_RS01510 (QMO40_01510) | 312517..312921 | - | 405 | WP_283386521.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMO40_RS01515 (QMO40_01515) | 312918..313157 | - | 240 | WP_283386522.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QMO40_RS01520 (QMO40_01520) | 313412..313777 | - | 366 | WP_005621166.1 | 50S ribosomal protein L7/L12 | - |
QMO40_RS01525 (QMO40_01525) | 313833..314324 | - | 492 | WP_025235143.1 | 50S ribosomal protein L10 | - |
QMO40_RS01530 (QMO40_01530) | 314611..315300 | - | 690 | WP_025235142.1 | 50S ribosomal protein L1 | - |
QMO40_RS01535 (QMO40_01535) | 315305..315733 | - | 429 | WP_025235141.1 | 50S ribosomal protein L11 | - |
QMO40_RS01540 (QMO40_01540) | 316148..316711 | - | 564 | WP_025235140.1 | transcription termination/antitermination protein NusG | - |
QMO40_RS01545 (QMO40_01545) | 316713..317126 | - | 414 | WP_025235139.1 | preprotein translocase subunit SecE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15207.80 Da Isoelectric Point: 7.6274
>T282400 WP_283386521.1 NZ_CP125805:c312921-312517 [Mannheimia bovis]
MIYMLDTNILIYLMKNRPLAVAERVAQLTPSDQLVMSFITYAELLKGANGSANPEKALANIEKLKQRISVVYPNEKICEF
YGVWANKLKLQGKPIGGNDLWIACYALACNAILVTHNVKEFERIEALNWQDWTC
MIYMLDTNILIYLMKNRPLAVAERVAQLTPSDQLVMSFITYAELLKGANGSANPEKALANIEKLKQRISVVYPNEKICEF
YGVWANKLKLQGKPIGGNDLWIACYALACNAILVTHNVKEFERIEALNWQDWTC
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|