Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-YefM |
Location | 260095..260783 | Replicon | chromosome |
Accession | NZ_CP125805 | ||
Organism | Mannheimia bovis strain 39324.S-11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | W0Q2A7 |
Locus tag | QMO40_RS01245 | Protein ID | WP_025235180.1 |
Coordinates | 260095..260517 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QMO40_RS01250 | Protein ID | WP_283386486.1 |
Coordinates | 260517..260783 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO40_RS01225 (QMO40_01225) | 256138..257199 | + | 1062 | WP_283386482.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
QMO40_RS01230 (QMO40_01230) | 257224..257883 | + | 660 | WP_283386483.1 | NAD(P)H-dependent oxidoreductase | - |
QMO40_RS01235 (QMO40_01235) | 258017..259075 | + | 1059 | WP_283386484.1 | NAD(P)-dependent alcohol dehydrogenase | - |
QMO40_RS01240 (QMO40_01240) | 259205..260095 | - | 891 | WP_283386485.1 | LysR family transcriptional regulator | - |
QMO40_RS01245 (QMO40_01245) | 260095..260517 | - | 423 | WP_025235180.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMO40_RS01250 (QMO40_01250) | 260517..260783 | - | 267 | WP_283386486.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QMO40_RS01255 (QMO40_01255) | 261015..261863 | + | 849 | WP_283386487.1 | MBL fold metallo-hydrolase | - |
QMO40_RS01260 (QMO40_01260) | 261911..262570 | + | 660 | WP_283386488.1 | NAD(P)H-binding protein | - |
QMO40_RS01265 (QMO40_01265) | 262611..263756 | - | 1146 | WP_283386489.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
QMO40_RS01270 (QMO40_01270) | 264365..265009 | + | 645 | WP_283386490.1 | RNA pyrophosphohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15907.45 Da Isoelectric Point: 7.5204
>T282399 WP_025235180.1 NZ_CP125805:c260517-260095 [Mannheimia bovis]
MFLLDTNVVSELRKVKKGMANPNVVAWLAKQNPNDFYINSIVLMELERGVLAMERKDPTQGVHLRHWQNLFLNQILHKPI
LPIDETTAQICAKLHIPDHAPENDAWIAASAIQHHLILVTRNTADFAKTGAKLFNPFEPQ
MFLLDTNVVSELRKVKKGMANPNVVAWLAKQNPNDFYINSIVLMELERGVLAMERKDPTQGVHLRHWQNLFLNQILHKPI
LPIDETTAQICAKLHIPDHAPENDAWIAASAIQHHLILVTRNTADFAKTGAKLFNPFEPQ
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|