Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4576288..4576904 | Replicon | chromosome |
Accession | NZ_CP125781 | ||
Organism | Trabulsiella odontotermitis strain TBY01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QMG90_RS21735 | Protein ID | WP_283281879.1 |
Coordinates | 4576288..4576659 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QMG90_RS21740 | Protein ID | WP_283281881.1 |
Coordinates | 4576662..4576904 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMG90_RS21715 (QMG90_21715) | 4571629..4572972 | + | 1344 | WP_283281874.1 | VWA domain-containing protein | - |
QMG90_RS21720 (QMG90_21720) | 4572990..4574486 | + | 1497 | WP_283281876.1 | HAMP domain-containing sensor histidine kinase | - |
QMG90_RS21725 (QMG90_21725) | 4574491..4575177 | + | 687 | WP_283284021.1 | response regulator transcription factor | - |
QMG90_RS21730 (QMG90_21730) | 4575320..4576249 | + | 930 | WP_283281877.1 | formate dehydrogenase accessory protein FdhE | - |
QMG90_RS21735 (QMG90_21735) | 4576288..4576659 | - | 372 | WP_283281879.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMG90_RS21740 (QMG90_21740) | 4576662..4576904 | - | 243 | WP_283281881.1 | CopG family transcriptional regulator | Antitoxin |
QMG90_RS21745 (QMG90_21745) | 4577027..4577968 | - | 942 | WP_283284022.1 | fatty acid biosynthesis protein FabY | - |
QMG90_RS21750 (QMG90_21750) | 4578013..4578450 | - | 438 | WP_283281883.1 | D-aminoacyl-tRNA deacylase | - |
QMG90_RS21755 (QMG90_21755) | 4578447..4579319 | - | 873 | WP_283281885.1 | virulence factor BrkB family protein | - |
QMG90_RS21760 (QMG90_21760) | 4579313..4579912 | - | 600 | WP_054180954.1 | glucose-1-phosphatase | - |
QMG90_RS21765 (QMG90_21765) | 4580766..4581383 | + | 618 | WP_038161452.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13543.65 Da Isoelectric Point: 5.8431
>T282398 WP_283281879.1 NZ_CP125781:c4576659-4576288 [Trabulsiella odontotermitis]
MSGSALFDTNILIDLFSGRQAAIAALEAYPSQRAISLITWIEVMVGVPKYGDEERTKAVLELFDIIDINRDIAAKSIELR
RTHGMRLPDALILATAQVNNRSLVTRNTKDFAGIPGVVTPYQL
MSGSALFDTNILIDLFSGRQAAIAALEAYPSQRAISLITWIEVMVGVPKYGDEERTKAVLELFDIIDINRDIAAKSIELR
RTHGMRLPDALILATAQVNNRSLVTRNTKDFAGIPGVVTPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|