Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4046351..4046873 | Replicon | chromosome |
Accession | NZ_CP125781 | ||
Organism | Trabulsiella odontotermitis strain TBY01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QMG90_RS19170 | Protein ID | WP_283281283.1 |
Coordinates | 4046351..4046641 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QMG90_RS19175 | Protein ID | WP_054179604.1 |
Coordinates | 4046631..4046873 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMG90_RS19155 (QMG90_19155) | 4041686..4043323 | + | 1638 | WP_283281281.1 | alpha,alpha-phosphotrehalase | - |
QMG90_RS19160 (QMG90_19160) | 4043745..4045883 | + | 2139 | WP_283281282.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QMG90_RS19165 (QMG90_19165) | 4045883..4046347 | + | 465 | WP_038156163.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QMG90_RS19170 (QMG90_19170) | 4046351..4046641 | - | 291 | WP_283281283.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMG90_RS19175 (QMG90_19175) | 4046631..4046873 | - | 243 | WP_054179604.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QMG90_RS19180 (QMG90_19180) | 4046969..4048879 | - | 1911 | WP_283281287.1 | BglG family transcription antiterminator | - |
QMG90_RS19185 (QMG90_19185) | 4048929..4050080 | - | 1152 | WP_283281288.1 | lactonase family protein | - |
QMG90_RS19190 (QMG90_19190) | 4050161..4050901 | - | 741 | WP_283281289.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11133.03 Da Isoelectric Point: 9.8542
>T282396 WP_283281283.1 NZ_CP125781:c4046641-4046351 [Trabulsiella odontotermitis]
MSYELEFDPRALKEWKKLGSTVRSQFKKKLAEVLVHPHVESARLHDLPDCYKIKLKTAGYRLVYQVREEIVVVMVIAVGK
REKSAVYASADKRLDE
MSYELEFDPRALKEWKKLGSTVRSQFKKKLAEVLVHPHVESARLHDLPDCYKIKLKTAGYRLVYQVREEIVVVMVIAVGK
REKSAVYASADKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|