Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3592766..3593445 | Replicon | chromosome |
| Accession | NZ_CP125781 | ||
| Organism | Trabulsiella odontotermitis strain TBY01 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | QMG90_RS17035 | Protein ID | WP_000854680.1 |
| Coordinates | 3593104..3593445 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | A0A5C1BXL1 |
| Locus tag | QMG90_RS17030 | Protein ID | WP_023336793.1 |
| Coordinates | 3592766..3593083 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG90_RS16985 (QMG90_16985) | 3588203..3589024 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| QMG90_RS16990 (QMG90_16990) | 3589241..3589942 | + | 702 | WP_006812588.1 | WYL domain-containing protein | - |
| QMG90_RS16995 (QMG90_16995) | 3589983..3590219 | + | 237 | WP_001144031.1 | protein YpjK | - |
| QMG90_RS17000 (QMG90_17000) | 3590219..3590662 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| QMG90_RS17005 (QMG90_17005) | 3590686..3591153 | + | 468 | WP_001581459.1 | protein YkfB | - |
| QMG90_RS17010 (QMG90_17010) | 3591230..3591469 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| QMG90_RS17015 (QMG90_17015) | 3591567..3592025 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| QMG90_RS17020 (QMG90_17020) | 3592041..3592517 | + | 477 | WP_023336794.1 | RadC family protein | - |
| QMG90_RS17025 (QMG90_17025) | 3592526..3592747 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| QMG90_RS17030 (QMG90_17030) | 3592766..3593083 | + | 318 | WP_023336793.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| QMG90_RS17035 (QMG90_17035) | 3593104..3593445 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| QMG90_RS17045 (QMG90_17045) | 3594014..3595267 | - | 1254 | WP_283280800.1 | glutamate-5-semialdehyde dehydrogenase | - |
| QMG90_RS17050 (QMG90_17050) | 3595278..3596381 | - | 1104 | WP_283280802.1 | glutamate 5-kinase | - |
| QMG90_RS17055 (QMG90_17055) | 3596682..3597779 | + | 1098 | WP_283280804.1 | porin | - |
| QMG90_RS17060 (QMG90_17060) | 3597834..3598235 | - | 402 | WP_283280805.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T282395 WP_000854680.1 NZ_CP125781:3593104-3593445 [Trabulsiella odontotermitis]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1FHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C1BXL1 |