Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3457488..3458109 | Replicon | chromosome |
| Accession | NZ_CP125781 | ||
| Organism | Trabulsiella odontotermitis strain TBY01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QMG90_RS16380 | Protein ID | WP_283280708.1 |
| Coordinates | 3457903..3458109 (-) | Length | 69 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QMG90_RS16375 | Protein ID | WP_283280707.1 |
| Coordinates | 3457488..3457901 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG90_RS16355 (QMG90_16355) | 3453422..3453880 | - | 459 | WP_283280702.1 | Lrp/AsnC family transcriptional regulator | - |
| QMG90_RS16360 (QMG90_16360) | 3454048..3454866 | - | 819 | WP_283280703.1 | HMP-PP phosphatase | - |
| QMG90_RS16365 (QMG90_16365) | 3454992..3456707 | + | 1716 | WP_283280704.1 | SgrR family transcriptional regulator | - |
| QMG90_RS16370 (QMG90_16370) | 3456760..3457455 | + | 696 | WP_283280706.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| QMG90_RS16375 (QMG90_16375) | 3457488..3457901 | - | 414 | WP_283280707.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QMG90_RS16380 (QMG90_16380) | 3457903..3458109 | - | 207 | WP_283280708.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QMG90_RS16385 (QMG90_16385) | 3458161..3458559 | - | 399 | WP_283280709.1 | YbgC/FadM family acyl-CoA thioesterase | - |
| QMG90_RS16390 (QMG90_16390) | 3458667..3459038 | - | 372 | WP_283280710.1 | helix-hairpin-helix domain-containing protein | - |
| QMG90_RS16395 (QMG90_16395) | 3459187..3461061 | - | 1875 | WP_283280711.1 | peptidylprolyl isomerase | - |
| QMG90_RS16400 (QMG90_16400) | 3461263..3461535 | - | 273 | WP_007373541.1 | nucleoid-associated protein HU-beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3449834..3466310 | 16476 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7695.07 Da Isoelectric Point: 11.6157
>T282394 WP_283280708.1 NZ_CP125781:c3458109-3457903 [Trabulsiella odontotermitis]
MNSKALIAELIADGWILIRVTGSHHHFRHPIKRGLVTVPHPKKDLPVGTVKSIRRQAGYENPLALPWR
MNSKALIAELIADGWILIRVTGSHHHFRHPIKRGLVTVPHPKKDLPVGTVKSIRRQAGYENPLALPWR
Download Length: 207 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15063.27 Da Isoelectric Point: 4.4926
>AT282394 WP_283280707.1 NZ_CP125781:c3457901-3457488 [Trabulsiella odontotermitis]
MYYPIVVESGDEKHAWGVIVPDLPGCFSAGDTLDEAIVNAREAITAHIELLVEMGEDIPLISTVNDLVAQPQYQGMTWAL
VDIDVSRLLGGSEKINVTLPKSLIDRIDRCVARHPEFKSRSGFLAQAALERITKPFS
MYYPIVVESGDEKHAWGVIVPDLPGCFSAGDTLDEAIVNAREAITAHIELLVEMGEDIPLISTVNDLVAQPQYQGMTWAL
VDIDVSRLLGGSEKINVTLPKSLIDRIDRCVARHPEFKSRSGFLAQAALERITKPFS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|